ICM Manual v.3.6
by Ruben Abagyan Copyright © 2008, Molsoft LLC Sep 1 2010
|
[ Abs | Acc | Acos | Acosh | Align | Angle | Area | Asin | Asinh | Ask | Askg | Atan | Atan2 | Atanh | Atom | Augment | Axis | Bfactor | Boltzmann | Box | Bracket | Cad | Ceil | Cell | Charge | Chemical | Cluster | Color | Consensus | Corr | Cos | Cosh | Count | CubicRoot | Date | Deletion | Disgeo | Distance | Eigen | Energy | Error | Error soap | Exist | Existenv | Extension | Exp | Field | File | Find | Floor | Formula | Getarg | Getenv | Gradient | Grob | Group | Header | Histogram | Iarray | IcmSequence | Image | Index | Indexx | Insertion | Info | Info image | Integer | Integral | Interrupt | Label | Length | LinearFit | LinearModel | Log | Map | Mass | Moment | Match | Matrix | Max | MaxHKL | Mean | Min | Money | Mod | Mol | Name | Namex | Next | Nof | Norm | Normalize | NotInList | Obj | Occupancy | Path | Parray | Pattern | Pi | Potential | Power | Predict | Probability | Profile | Property | Putarg | Putenv | Radius | Random | Rarray | Real | Remainder | Reference | Replace | Res | Resali | Resolution | Ring | Rfactor | Rfree | Rmsd | Rot | Sarray | Score | Select | Sequence | Shuffle | Sign | Sin | Sinh | Site | Slide | Smiles | Smooth | Sql | Sqrt | Sphere | SoapMessage | Sort | Split | Srmsd | String | Sstructure | Sum | Symgroup | Table | Tan | Tanh | Tensor | Temperature | Time | Tointeger | Tolower | Toreal | Torsion | Tostring | Toupper | Tr123 | Tr321 | Trace | Trans | Transform | Transpose | Trim | Trim sequence | Turn | Type | Unique | Unix | Value | Value soap | Vector | Version | Volume | View | Warning | Xyz ]
ICM-shell functions are an important part of the ICM-shell environment.
They have the following general format:
FunctionName ( arg1, arg2, ... )
and return an ICM-shell object of one of the following types:
integer, real, string, logical, iarray,
rarray, sarray, matrix, sequence, profile, alignments,
maps, graphics objects, a.k.a. grob and selections.
The order of the function arguments is fixed in contrast to that of commands.
The same function may perform different operations and return ICM-shell
constants of different type depending on the arguments types and order.
ICM-shell objects returned by functions have no names, they may be parts
of algebraic expressions and should be formally considered as 'constants'.
Individual 'constants' or expressions can be assigned to a named variable.
Function names always start with a capital letter.
Example:
show Mean(Random(1.,3.,10))
absolute value function.
Abs ( real )
- returns real absolute value.
Abs ( integer )
- returns integer absolute value.
Abs ( rarray )
- returns rarray of absolute values.
Abs ( iarray )
- returns iarray of absolute values.
Abs ( map )
- returns map of absolute values of the source map.
Examples:
a=Abs(-5.) # a=5.
print Abs({-2.,0.1,-3.}) # prints rarray {2., 0.1, 3.}
if (Abs({-3, 1})=={3 1}) print "ok"
accessibility selection function.
It returns residues or atoms with relative solvent accessible area greater than certain threshold.
Important: The surface area must be calculated before this function call.
The Acc function just uses surface values, it does not reevaluate them.
Therefore, make sure that the show area command (or show energy,
minimize , etc. with the "sf" surface term turned on),
has been executed before you use the Acc function.
If you specify the threshold explicitly, it must range from 0.0 to 1.0, otherwise it is set to 0.25
for residue selections and 0.1 for atom selections.
Acc ( rs_ , [ r_Threshold ] )
- returns residue selection, containing a subset of specified residues `rs_
for which the ratio of their current accessible surface to the standard exposed surface is greater than
the specified or default threshold (0.25 by default).
ICM stores the table of standard residue accessibilities in an unfolded state calculated
in the extended Gly-X-Gly dipeptide for all amino acid residue types.
It can be displayed by the show residue type command,
or by calling function Area( s_residueName ),
and the numbers may be modified in the icm.res file.
The actual solvent accessible surface, calculated by a fast
dot-surface algorithm, is divided by the standard one and the residue
gets selected if it is greater than the specified or default threshold.
( r_Threshold parameter is 0.25 by default).
Acc ( as_select, [ r_Threshold ] )
- returns atom selection,
containing atoms with accessible surface divided by the total surface of the
atomic sphere in a standard covalent environment greater than the
specified or default threshold (0.1). Accessibility at this level does not make
as much sense as at the residue level. The standard surface of the atom
was determined for standard amino-acid residues. Note that hydrogens were NOT
considered in this calculation. Therefore, to assign surface areas to the
atoms use
show surface area a_//!h* a_//!h*
command
or the
show energy "sf"
command.
You may later propagate the accessible atomic layer by
applying Sphere( as_ , 1.1), where 1.1 is larger than a typical
X-H distance but smaller than the distance between two heavy atoms.
(the optimal r_Threshold at the atomic level used as the default is 0.1,
note that it is different from the previous ).
Examples:
# let us select interface residues
read object s_icmhome+"complex"
# display all surface residues
show surface area
display Acc( a_/* )
# now let us show the interface residues
display a_1,2
color a_1 yellow
color a_2 blue
show surface area a_1 a_1 # calculate surface of
# the first molecule only
# select interface residues
# of the first molecule
color red Sphere(a_2/* a_1/* 4.) & Acc(a_1/*)
read object s_icmhome+"crn"
show energy "sf"
display
display cpk Acc(a_//* 0.1) # display accessible atoms
show surface area # prior to invoking Acc function
# surface area should be calculated
color Acc(a_/*) red # color residues with relative
# accessibility > 25% red
arccosine trigonometric function
Returns angles in degrees.
Acos ( real | integer )
- returns the real arccosine of its real or integer argument.
Acos ( rarray )
- returns the rarray of arccosines of rarray elements.
Examples:
print Acos(1.) # equal to 0.
print Acos(1) # the same
print Acos({-1., 0., 1.}) # returns {180. 90. 0.}
inverse hyperbolic cosine function.
Acosh ( real | integer )
- returns the real inverse hyperbolic cosine of its real or integer argument.
Acosh ( rarray )
- returns the rarray of inverse hyperbolic cosines of rarray elements.
Examples:
print Acosh(1.) # returns 0
print Acosh(1) # the same
print Acosh({1., 10., 100.}) # returns {0., 2.993223, 5.298292}
[ sequence | structural alignment | sub_alignments ]
family of the alignment functions. These function return an alignment icm-shell object and perform
- sequence alignment (with the Needleman and Wunsch algorithm with zero gap end penalties
( ZEGA ),
- structural alignment, or
- sub-alignment extraction
Pairwise sequence alignment or sequence-structure alignment |
Align ( [ sequence1, sequence2 ] [ area ] [ M_scores ] )
- returns ZEGA- alignment.
If no arguments are given, the function aligns the first two sequences in the sequence list.
For sequence alignments, the ZEGA-statistics of
structural significance ( Abagyan, Batalov, 1997) is given and can be additionally
evaluated with the Probability function.
The reported pP value is -Log(Probability,10).
Returned variables:
- i_out - the number of identical residues in the alignment
- r_out - contains Log( Probability_of_structural_dissimilarity ) only for pairwise alignments
- r_2out - percent identity of the alignment.
Simple pairwise sequence alignment
Align( )
Align( seq1 seq2 )
- returns an alignment. The alignMethod preference allows you to perform two types of pairwise sequence
alignments: "ZEGA" and "H-align". If you skip the arguments, the first
two sequence are aligned.
Example:
read sequences s_icmhome+"sh3.seq" # read 3 sequences
print Align(Fyn,Spec) # align two of them
Align( ) # the first two
a=Align( sequence[1] sequence[3] ) # 1st and 3rd
if(r_out > 5.) print "Sequences are struct. related"
Aligning with custom residue weights or weights according to surface accessible area
Align( seq1 seq2 area )
Option area will use relative residue accessibilities to weight the residue-residue
substitution values in the course of the alignment (see also accFunction ).
The weights must be positive and less than 2.37 . Try to be around or less than 1. since
relative accessibilities are always in [0.,1.] range.
Values larger than 2.37 do not work well anyway with the existing alignment matrices
and gap parameters.
Use the Trim function to adjust the values, e.g. Trim( myweights , 0.1,2.3 ) ).
E.g.
read pdb "1lbd"
show surface area
make sequence
Info> sequence 1lbd_m extracted
1lbd_a # see the relative areas
read pdb sequence "1fm6.a/" # does not have areas
Info> 1 sequence 1fm6_a read from /data/pdb/fm/pdb1fm6.ent.Z
ali3d = Align( 1lbd_a 1fm6_a area )
This can also be used to assign custom weights with the following commands
set area seq1 R_weights # must be > 0. and less than 2.37
Align( seq1 seq2 area )
Introducing positional restraints into the alignment matrix
Align( seq1 seq2 M_positionalScores )
If sequence similarity is in the "twilight zone" and the alignment is not obvious,
the regular comp_matrix{residue substitution matrix} is not sufficient
to produce a correct alignment and additional help is needed.
This help may come in a form of the positional information, e.g.
histidine 55 in the first sequence must align with histidine 36 in the second
sequence, or the predicted alpha-helix in the first sequence preferably aligns with
alpha-helix in the second one.
In this case you can prepare a matrix of extra scores for each pair of positions in
two sequences, e.g.
seq1 = Sequence("WEARSLTTGETGYIPSA")
seq2 = Sequence("WKVEVNDRQGFVPAAY")
Align()
# Consensus W.#. .~~.~G%#P^
WEARSLTTGETGYIPS--
WKVE--VNDRQGFVPAAY
m = Matrix(17,16,0.)
m[10,4] = 3. # reward alignment of E in seq1[10] and E in seq2[4]
Align(seq1 seq2 m )
# Consensus W.# E ~G%#P^
WEARSLTTGE----TGYIPS--
WKV------EVNDRQGFVPAAY
The alignSS macro shows a more elaborate example in which extra scores are prepared
to encourage alignments of the same secondary structure elements.
Warning. The alignment procedure is rather subtle and may be sensitive to the gap parameters and
the comparison matrix. Avoid matrix values comparable with gap opening penalty.
See also: Probability( ali .. ) for local alignment reliability.
Local pairwise structural alignment |
[ alignment-from-tethers ]
Two types of structural alignments or mixed sequence/structural alignments
can be performed with the Align function.
Align( seq_1 seq_2 distance [ i_window ] [ r_seq_weight ] )
- performs local structural alignment, using distance RMSD as structural fitness
criterion. The RMSD is calculated in a window i_window and the dynamic programming
algorithm combines structural scores with sequence alignment scores if r_seq_weight > 0.,
Align( seq_1 seq_2 superimpose [ i_window ] [ r_seq_weight ] )
- performs local structural alignment, using superposition followed by coordinate RMSD
calculation as structural fitness
criterion. The RMSD is calculated in a window i_window and the dynamic programming
algorithm combines structural scores with sequence alignment scores if r_seq_weight > 0.,
In both cases the function uses the dynamic algorithm to find the alignment
of the locally structurally similar backbone conformations.
The alignment based on optimal structural superposition of two 3D structures
may be different from purely sequence alignment
Preconditions:
- sequences must be linked to 3D molecules to access the coordinate information;
- two 3D structures must have a superposable subsets
The residue-label-carrying atoms (see the set label a_ command)
will be used for structural superpositions.
r_seq_weight is used to add sequence amino acid substitution values to the 3D similarity signal.
See also: align ms1 ms2 function
Deriving an alignment from tethers between two 3D objects
Align ( ms_ )
- returns alignment between sequences of the specified molecule and the template molecule
to which it is tethered. The alignment is deduced from the tethers imposed.
Example:
build string "se ala his leu gly trp ala" name="a" # obj. a
build string "se his val gly trp gly ala" name="b" # obj. b
set tether a_2./1:3 a_1./2:4 align # impose tethers
show Align(a_2.1) # derive alignment from tethers
write Align(a_2.1) "aa" # save it to a file
Extracting pairwise alignment sequences from a multiple alignment |
Align ( ali_, seq_1, seq_2 )
- returns a pairwise sub- alignment of the input alignment ali_,
reorders of sequences in the alignment according to the order of arguments.
Extracting a multiple alignment of a subset of sequences from a multiple alignment
Align ( ali_, I_seqNumbers )
- returns a reordered and/or partial alignment .
Sequences are taken in the order specified in I_seqNumbers.
Examples:
# 14 sequences
read alignment msf s_icmhome + "azurins"
# extract a pairwise alignment by names
aa = Align(azurins,Azu2_Metj,Azur_Alcde)
# reordered sub-alignment extracted by numbers
bb = Align(azurins,{2 5 3 4 10 11 12})
Resorting alignment in the order of sequence input with the Align ( ali_, I_seqNumbers ) function.
Load the following macro and apply it to your alignment. Example:
macro reorderAlignmentSeq( ali_ )
nn=Name(ali_) # names in the alignment order
ii=Iarray(Nof(nn))
j=0
for i=1,Nof(sequence) # the original order
ipos = Index( nn, Name(sequence[i] ) )
if ipos >0 then
j=j+1
ii[j] = ipos
endif
endfor
ali_new = Align( ali_ ii )
keep ali_new
endmacro
calculates planar angle in degrees. Returns real value.
Angle ( as_atom )
- returns the planar angle defined by the specified atom and two previous atoms in the
ICM-tree. For example, Angle(a_/5/c) is defined by C-Ca-N atoms of the 5-th residue.
You may type:
print Angle( # and then click the atom of interest.
Angle ( as_atom1 , as_atom2 , as_atom3 )
- returns the planar angle defined by three atoms.
Angle ( R_3point1 , R_3point2 , R_3point3 )
- returns the planar angle defined by the three points.
Angle ( R_vector1 , R_vector2 )
- returns the planar angle between the two vectors.
Examples:
d=Angle( a_/4/c ) # d equals N-Ca-C angle
print Angle( a_/4/ca a_/5/ca a_/6/ca ) # virtual Ca-Ca-Ca planar angle
The rotation angle corresponding to a transformation vector is returned as r_out by
the Axis( R_12 ) function.
[ Area contact matrix ]
calculates surface area. A quick guide:
Area( grob [error] ) ⇒ r
Area( as_ | rs_ ) ⇒ R_atomAreas|R_resAreas # needs surface calculation beforehand
Area( rs_ type ) ⇒ R_maxAreas_in_GLY_X_GLY
Area( as_ R_typeEyPerArea energy ) ⇒ R_atomEnergies
Area( seq ) ⇒ R_relAreasPerResidue
Area( s_icmResType ) ⇒ r
Area( rs_ rs_2 ) ⇒ M_contactAreas
Note that if an atom selection is provided as an argument the surface area needs to be computed beforehand with
the show area or show energy "sf" command. The detailed description can be found below:
Area ( grob [error] )
- returns real surface area of a solid graphics object.
Option error makes it return the fraction of the surface that is not closed to detect the holes or missing
patches in what supposed to be a closed surface. (e.g.
g = Grob("SPHERE",1.,2)
show Area(g)
if(Area(g error)>0.01) print "Surface not closed" # check for holes
See also: the Volume( grob ) function, the split command and
How to display and characterize protein cavities
section.
Area ( as_ [ [ R_userSolvationDensities ] [ energy ] ] )
- returns rarray of pre-calculated solvent accessible areas or energies for selected atoms `as_ .
This areas are set by the show area surface|skin of show energy "sf" commands.
Make sure to clean up the areas with the set area a_//* 0. command before computing the areas
with show energy command since the command ignores hydrogens.
With option energy returns the product of
the individual atomic accessibilities by the atomic surface energy density. The values of the density
depend on the surfaceMethod preference and are stored in the icm.hdt file. The "contant tension"
value of the preference is a trivial case in which all areas are multiplied by the surfaceTension parameter.
For the "atomic solvation" and "apolar" styles, the densities depend on atom types.
Normally the atomic solvation densities are taken from the icm.hdt file where the density values are listed
for each hydration atom type for "atomic solvation" and "apolar" styles. However, you can provide
your own array of n values R_userSolvationDensities with the number of elements less or equal to the
number of types to overwrite the first n types.
Examples:
read object s_icmhome+"crn.ob"
set area a_//* 0.
surfaceMethod = "apolar"
show energy "sf" # only heavy atoms
Area( a_/15:30/* ) # areas of this atoms
#
# Now let us redefine the first three solvation parameters
# of icm.hdt and calculated E*A contributions of selected atoms
#
Area( a_/15:30/* {10., 20. 30.} energy)
Area ( rs_ )
- returns rarray of pre-calculated solvent accessible areas for selected residues `rs_ .
These accessibilities depend on conformation.
Area ( rs_ type )
- returns rarray of maximal standard solvent accessible areas for selected residues `rs_ .
These accessibilities are calculated for each residue in standard extended conformation
surrounded by Gly residues. Those accessibilities
depend only on the sequence of the selected residues and do NOT depend on its conformation.
To calculate normalized accessibilities, divide Area( rs_ ) by Area( rs_ type )
Example:
read object s_icmhome+"crn.ob"
show surface area
a=Area(a_/* ) # absolute conformation dependent residue accessibilities
b=Area(a_/* type ) # maximal residue accessibilities in the extended conformation
c = a/b # relative (normalized) accessibilities
Area ( resCode ) ⇒ r_standard_area
- returns the real value of solvent accessible area for the specified residue type in the standard
"exposed" conformation surrounded by the Gly residues, e.g. Area("ala").
It is the same value as the Area( .. type ) function.
Area( seq ) ⇒ R_relAreasPerResidue
- returns an array of relative areas per residue stored with the sequence by the make sequence command from
molecules in which the areas had been computed beforehand. Note that the sequence keeps only a very limited
accuracy areas. Example:
read pdb "1crn"
show area surface
make sequence # 1crn_a now has relative areas
group table t Sarray( a_/* residue) Area(1crn_a) Area(a_/*)/Area(a_/* type)
show t
Important : "pre-calculated" above means that before invoking
this function, you should calculate the surface by
show area surface
,
show area skin
or
show energy "sf"
commands.
Examples:
build string "se ala his leu gly trp lys ala"
show area surface # calculate surface area
a = Area(a_//o*) # individual accessibilities of oxygens
stdarea = Area("lys") # standard accessibility of lysine
# More curious example
read object s_icmhome+"crn.ob"
show energy "sf" # calculate the surface energy contribution
# (hence, the accessibilities are
# also calculated)
assign sstructure a_/* "_"
# remove current secondary structure assignment
# for tube representation
display ribbon
# calculate smoothed relative accessibilities
# and color tube representation accordingly
color ribbon a_/* Smooth(Area(a_/*)/Area(a_/* type) 5)
# plot residue accessibility profile
plot Count(1 Nof(a_/*)) Smooth(Area(a_/*)/Area(a_/* type) 5) display
See also: Acc( ) function.
Area ( rs_1 rs_2 )
- returns rarray of areas of contact between selected residues.
You can do it for intra-molecular residue contacts, in which case
both selections should be the same, i.e. Area(a_1/* a_1/*) ;
or, alternatively, you can analyze intermolecular residue contacts,
for example, Area(a_1/A a_2/A).
See also the
Cad function, and example in
plot area in which a contact matrix is
calculated via interatomic Ca-Ca distances.
The table of the pairwise contact area differences is written to
the
s_out string which can later be read into
a proper table via:
read column group name="aa" input=s_out and sorted by the area (see below).
Example:
read object s_icmhome+"crn.ob" # good old crambin
s=String(Sequence(a_/A))
PLOT.rainbowStyle="blue/rainbow/red"
plot area Area(a_/A, a_/A) comment=s//s color={-50.,50.} \
link transparent={0., 2.} ds
read object s_icmhome+"complex"
plot area Area(a_1/A, a_2/A) grid color={-50.,50.} \
link transparent={0., 2.} ds
arcsine trigonometric function
Returned values are in degrees.
Asin ( real | integer)
- returns the real
arcsine of its real or integer argument.
Asin ( rarray )
- returns the
rarray
of arcsines of rarray elements.
Examples:
print Asin(1.) # equal to 90 degrees
print Asin(1) # the same
print Asin({-1., 0., 1.}) # returns {-90., 0., 90.}
inverse hyperbolic sine function.
Asinh ( real)
- returns the real
inverse hyperbolic sine of its real argument.
Asinh ( rarray)
- returns the rarray of inverse hyperbolic sines of rarray elements.
Examples:
print Asinh(1.) # returns 0.881374
print Asinh(1) # the same
print Asinh({-1., 0., 1.}) # returns {-0.881374, 0., 0.881374}
interactive input function. Convenient in macros.
Ask( s_prompt, i_default )
- returns entered integer or default.
Ask ( s_prompt, r_default )
- returns entered real or default.
Ask ( s_prompt, l_default )
- returns entered logical or default.
Ask ( s_prompt, s_default [simple] )
- returns entered string
or default. Option simple suppressed interpretation of the input and makes
quotation marks unnecessary.
Examples:
windowSize=Ask("Enter window size",windowSize)
s_mask=Ask("Enter alignment mask","xxx----xxx")
grobName=Ask("Enter grob name","xxx")
display $grobName
show Ask("Enter string, it will be interpreted by ICM:", "")
#e.g. Consensus( myAlignm )
show Ask("Enter string:", "As Is",simple)
#your input taken directly as a string
See also: Askg
interactive input function that generates a GUI dialog.
Return entered text Askg( s_prompt, i_default ) ⇒ s_returnsTheInputString
E.g.
Askg( "Enter your name", "" ) # empty default
Askg( "Enter your name", "Michael" )
Return the pressed button. Askg( s_Question, "Reply1/Reply2/.." simple ) ⇒ s_theReply
Makes a GUI dialog with the question and several alternatives
separated by a slash.
This dialog returns one of the string selected
,e.g. "Yes", "No" , or "Cancel" for the "Yes/No/Cancel" argument.
Example:
s = Askg("Do you like bananas?","Yes/No/Fried only",simple)
if s=="Fried only" print "Impressive"
Creating a special chemical dialog for library enumeration.This one is very specialized and is used in combi-chem generator.
Askg( chem_scaffold , enumerate ) ⇒ s_makeLib_React_Args
Askg( chem_reaction , enumerate ) ⇒ s_makeLib_React_Args
prompts for arguments for
the enumerate library or make reaction commands to create a combinatorial library.
To use this function you need to have the chemical array objects
with Markush-scaffolds or reactions, plus the building blocks
loaded into ICM.
The function returns a string with the agruments for
the enumerate library or make reaction commands.
E.g.
args = Askg( scaff1 enumerate )
enumerate library scaff1 $args
Askg( s_dialogDeclaration ) ⇒ "yes"/"no"
Generates a dialog from GUI dialog description text.
Values from each input field can be accessed either by :
$field_num
or
Getarg( i_field_num gui )
buf = "#dialog{\"Select InSilco Models\"}\n"
buf += "#1 l_Passive_GUT_Absorption (yes)\n"
buf += "#2 l_ToxCheck (no)\n"
buf += "#3 l_hERG_QSAR (yes)\n"
buf += "#4 s_Comment_Here ()\n"
Askg(buf)
print $1, $2, Getarg( 3 gui ), $4
Using Askg in shell, html-docs and table tool panels. These variants of the Askg function can also be used
as a part of an ICM script in dialogs generated from
built-in html documents, or in actions associated
with tables.
See also : gui programming
arctangent trigonometric function
Returned values are in degrees.
Atan ( real | integer )
- returns the real
arctangent of its real or integer argument.
Atan ( rarray )
- returns the rarray of arctangents of rarray elements.
Examples:
print Atan(1.) # equal to 45.
print Atan(1) # the same.
print Atan({-1., 0., 1.}) # returns {-45., 0., 45.}
arctangent trigonometric function.
Returned values are in degrees.
Atan2 ( r_x, r_y )
- returns the
real arctangent of r_y/r_x in the range -180. to 180. degrees
using the signs of both arguments to determine the quadrant of
the returned value.
Atan2 ( R_x R_y )
- returns the rarray
of arctangents of R_y/R_x elements as described above.
Examples:
print Atan2(1.,-1.) # equal to 135.
print Atan2({-1., 0., 1.},{-0.3, 1., 0.3}) # returns phases {-106.7 0. 73.3}
inverse hyperbolic tangent function.
Atanh ( real )
- returns the
real
inverse hyperbolic tangent of its real argument.
Atanh ( rarray )
- returns the rarray
of inverse hyperbolic tangents of rarray elements.
Examples:
print Atanh(0.) # returns 0.
print Atanh(1.) # returns error
print Atanh({-0.9999, 0., .9999}) # returns { -4.951719, 0., -4.951719 }
transforms the input selection to atomic level or returns an atom level selection.
Function is necessary since some of the commands/functions require a specific level of selection.
Atom( as|rs|ms|os ) ⇒ as_atomLevelSel
- a selection level transformation function
Atom( vs ) ⇒ as_firstAtomMovedByVar
- each variable be it a bond length, bond angle, torsion angle or phase angle in the ICM tree
has a single atom that is first moved when this variable is changed. This function returns this first atom(s).
Atom( as_icmAtom i ) # i-th preceding atom
- this function also uses the concept of the ICM tree and returns atoms i - th links before the selected one.
Atom( as1 [ as_where ] symmetry )
- returns a selection of atoms that are topologically equivalent to one atom defined by as1 .
The optional second selection argument as_where allows to narrow down the search for the equivalent atoms to the specified selection.
build smiles "C1CCCC1" # a cyclopentane
Atom( a_//c2 symmetry ) # returns 4 other equivalent carbons, c1,c3,c4,c5
#
build string "AFA" # a tripeptide with phenylalanine
Atom( a_/3/ce1 a_/3 symmetry ) # returns ce2 in phe
Atom( as tether )
- returns a sub-selection of as that has tethers .
Atom( vs i ) # i-th preceding atom for variables
Atom( label3d [i_item] ) ⇒ as_
Atom( pairDist_or_hbondPairDist ) ⇒ as_
make distance or make bond commands can be used to create distance lines and labels or hbonds, respectively, in the format of a "distance" object;
The Atom function then will return the atoms referenced in the object. E.g. display Atom( hbondpairs ) xstick cpk
Examples:
asel=Acc(a_2/his) # select accessible His residues of
# the second molecule
show Atom(asel) # show atoms of these residues
show Atom( v_//phi ) # carbonyl Cs
See also: the Res, Mol, and Obj functions.
creates augmented affine 4x4 space transformation matrix.
Augment( R_12transformationVector )
- rearranges the transformation vector into an augmented affine 4x4
space transformation matrix .
The augmented matrix can be presented as
a1 a2 a3 | a4
a5 a6 a7 | a8
a9 a10 a11 | a12
------------+----
0. 0. 0. | 1.
where {a1,a2,...a12} is the R_12transformationVector .
This matrix is convenient to use because it combines rotation
and translation.
To find the inverse transformation simply inverse the matrix:
M_inv = Power(Augment(R_12direct),-1))
R_12inv = Vector(M_inv)
To convert a 4x4 matrix back to a 12-transformation vector, use the Vector( M_4x4 ) function.
See also: Vector (the inverse function), symmetry transformations, and transformation vector.
Augment ( R_6Cell )
- returns 4x4 matrix
of oblique transformation from fractional coordinates to absolute coordinates
for given cell parameters {a b c alpha beta gamma}.
This matrix can be used to generate real coordinates.
It also contains vectors A, B and C. See also
an example.
Example:
read object s_icmhome+"crn.ob"
display a_crn. # load and display crambin: P21 group
obl = Augment(Cell( )) # extract oblique matrix
A = obl[1:3,1] # vectors A, B, C
B = obl[1:3,2]
C = obl[1:3,3]
g1=Grob("cell",Cell( )) # first cell
g2=g1+ (-A) # second cell
display g1 g2
Augment( R_3Vector )
- appends 1. to a 3D vector x,y,z (resulting in x,y,z,1. )
to allow direct arithmetics with augmented 4x4 space transformation matrices.
Augment( M_XYZblock )
- adds 1.,1.,..1. column to the Nx3 matrix of with x,y,z coordinates
to allow direct arithmetics with augmented 4x4 space transformation
matrices.
calculates rotation/screw axis corresponding to a transformation
Axis( { M_33Rot | R_12transformation } )
- returns rarray with x,y,z components of the normalized rotation/screw axis vector.
Additional information calculated and returned by the function:
- r_out rotation angle (in degrees);
- r_2out helix rise;
- R_out 3-rarray with a middle point on the axis.
See also:
How to find and display rotation/screw transformation axis
crystallographic temperature factors or custom atom parameters.
Bfactor ( [ as_ | rs_ ] [ simple ] )
- returns rarray of b-factors for the specified selection of atoms or residues. If selection of
residue level
is given, the average residue b-factors are returned. B-factors can also be
shown with the command show pdb.
Option simple returns a normalized b-factor. This option is possible
for X-ray objects containing b-factor information.
The read pdb command calculates the average B-factor for all non-water atoms.
The normalized B-factor is calculated as (b-b_av)/b_av .
This is preferable for coloring ribbons by B-factor since these numbers
only depend on the ratios to the average.
We recommend to use the following commands to color by b-factor:
color ribbon a_/ Trim(Bfactor( a_/ simple ),-0.5,3.)//-0.5//3. # or
color a_// Trim(Bfactor( a_// simple ),-0.5,3.)//-0.5//3. # for atoms
This scheme will give you a full sense of how bad a particular part
of the structure is.
See also: set bfactor.
Examples:
read pdb "1crn"
avB=Min(Bfactor(a_//ca)) # minimal B-factor of Ca-atoms
show Bfactor(a_//!h*) # array of B-factors of heavy atoms
color a_//* Bfactor(a_//*) # color previously displayed atoms
# according to their B-factor
color ribbon a_/A Bfactor(a_/A) # color the whole residue by mean B-fac.
returns the real Boltzmann constant = 0.001987 kcal/deg.
Example:
deltaE = Boltzmann*temperature # energy
the 3D graphics box function. This box can be displayed with the display box
command or by left-double-clicking on a grob,
and interactively moved and resized with the mouse.
One can select atoms inside a box by this operation:
as_ & Box( )
Box ( [ display ] )
- returns the 6- rarray with {Xmin ,Ymin ,Zmin ,Xmax ,Ymax ,Zmax }
parameters of the graphics box as defined on the screen. With the display keyword,
the function returns {0. 0. 0. 0. 0. 0.} if the box is not displayed (by default
it returns the last 6 values).
Box ( center )
- returns the 6- rarray with Xcenter,Ycenter,Zcenter,Xsize,Ysize,Zsize
parameters of the graphics box as defined on the screen.
Box ( as_ [ r_margin ] )
- returns the 6- rarray
with Xmin,Ymin,Zmin,Xmax,Ymax,Zmax parameters of the box surrounding
the selected atoms. The boundaries are expanded by r_margin
(default: 0.0 ).
Examples:
build string "se ala his" # a peptide
display box Box(a_/2 1.2) # surround the a_/2 by a box with 1.2A margin
color a_//* & Box( )
Box ( { g_ | m_ | R_6box } [ r_margin ] )
- returns the 6- rarray with Xmin,Ymin,Zmin,Xmax,Ymax,Zmax parameters of the box surrounding
the selected grob or map. The boundaries are expanded by r_margin
(default: 0.0 ).
bracket the grid potential map
by value or by space.
Bracket ( m_grid [ r_vmin r_vmax ] )
- returns the truncated map . The map will be truncated by value. The values beyond
r_vmin and r_vmax will be set to r_vmin and r_vmax
respectively.
Bracket ( m_grid [ R_6box ] )
- returns the modified map . All the values beyond the specified box will be
set to zero. Example:
make map potential "gh,gc,gb,ge,gs" a_1 Box()
m_ge = Bracket(m_ge, Box( a_1/15:18,33:47 )) # redefine m_ge
See also: Rmsd( map ) and Mean( map ), Min( map ), Max( map ) functions.
[ Cad1 | Cadalign ]
Contact Area Difference function
to measure geometrical difference between two different conformations
of the same molecule. Cad, as opposed to
Rmsd, is contact based and can measure the difference
in a wide range of model accuracies. Roughly speaking it measures the
surface weighted fraction of native contacts. Can be used to evaluate
the differences between several NMR models, the accuracy of models by
homology and the accuracy of docking solutions.
Cad can measure the geometrical difference between two conformations
in several different ways:
- between two conformations of the same protein based on full atom
residue-residue contact area calculation, Cad(..)
- between two conformations of the same protein based on Cbeta-Cbeta
distance evaluation (`Cad1{Cad}(.. distance ) .ICM uses an empirically derived
ContactStrength( Cb-distance ) function.
- between two homologous structures based preservation of the residue
contacts through the alignment ( Cad (.. alignment )) .
The contact strength in this case is also derived from the inter-residue
distances.
Comparing two conformations of the same molecule via residue-residue contact conservation. |
Cad ( rs_A1 [ rs_A2] rs_B1 [ rs_B2] [ distance | alignment ] )
- returns the real contact area difference measure (described in
Abagyan and Totrov, 1997)
between two conformations A and B of the same set of residue pairs
from two different objects.
The set of residue pairs in each object (A or B) can be defined in two ways:
- by a single selection rs_A1 : all pairs between selected residues
(is equivalent to rs_A1 rs_A1 )
- by two residue selections rs_A1 rs_A2: cross pairs between two sets
of selected residues (e.g. the contacts between two subunits)
The measure is a normalized sum of differences
between residue-residue contact areas in two conformations. The measure was
calibrated on a set of pairs of conformations. The average distortion due to
a noncrystallographic symmetry is about 5%, the average CAD between a pair of
models in an NMR entry is 15%. Note that the paper uses an additional factor
of 1.8 (i.e. CAD=1.8*Cad()) to bring the scale down to 0:100%, because about 40%
of the contacts are trivial contacts between the neighboring residues. However,
in evaluation of the docking solutions coefficient 1.8 should not be used.
Loops are somewhat intermediate, but still a coefficient of 1.8 is recommended
for consistency.
The whole matrix of contact area differences is returned in
M_out . This matrix can be nicely plotted with the
plot area M_out number ..
command (see example). The full matrix can also be
used to calculate the residue profile of the differences.
See also:
Area() function which calculates absolute residue-residue contact areas.
Options:
- distance option allows to compare approximations of the inter-residue
contact areas by the Ca and Cbeta positions. This allows to calculated deformations
between two homologous proteins which is not possible in the default mode in which
two chemically identical molecules are compared.
The residue pairs in two homologs are equivalenced according to the alignments
linked to the molecules. Residues deleted in a homologue
are considered to have zero contact.
- alignment option is described in Marsden, Abagyan, 2004, Bioinformatics, v20, 2333-2344.
Examples:
# Ab initio structure prediction, Overall models by homology
read pdb "cnf1" # one conformation of a protein
read pdb "cnf2" # another conformation of the same protein
show 1.8*Cad(a_1. a_2.) # CAD=0. - identical; =100. different
show 1.8*Cad(a_1.1 a_2.1) # CAD between the 1st molecules (domains)
show 1.8*Cad(a_1.1/2:10 a_2.1/2:10) # CAD in a window
PLOT.rainbowStyle = 2
plot area grid M_out comment=String(Sequence(a_1,2.1)) link display
# Loop prediction: 0% - identical; ~100% totally different
# CAD for loop 10:20 and its interactions with the environment
show 1.8*Cad(a_1.1/10:20 a_1.1/* a_2.1/10:20 a_2.1/*)
# CAD for loop 10:20 itself
show 1.8*Cad(a_1.1/10:20 a_1.1/10:20 a_2.1/10:20 a_2.1/10:20)
# Evaluation of docking solutions: 0% - identical; 100% totally different
read pdb "expr" # one conformation of a complex
read pdb "pred" # another conformation of the same complex
show Cad(a_1.1 a_1.2 a_2.1 a_2.2) # CAD between two docking solutions
#
# ANOTHER EXAMPLE: the most changed contacts
read object "crn"
copy a_ "crn2"
randomize v_ 5.
Cad(a_1. a_2.)
show s_out
read column group input= s_out name="cont"
sort cont.1
show cont
# the table looks like this (the diffs can be both + and -):
#>T cont
#>-1-----------2-----------3----------
-39. a_crn.m/38 a_crn.m/1
-36.4 a_crn.m/46 a_crn.m/4
-32.1 a_crn.m/46 a_crn.m/5
-29.8 a_crn.m/30 a_crn.m/9
-25.2 a_crn.m/37 a_crn.m/1
...
42.5 a_crn.m/43 a_crn.m/5
45.1 a_crn.m/44 a_crn.m/6
45.2 a_crn.m/43 a_crn.m/6
55.3 a_crn.m/46 a_crn.m/7
56. a_crn.m/45 a_crn.m/7
Comparing two different, but structurally homologs proteins, via residue-residue contact conservation. |
Cad ( rs_A1 [ rs_A2] rs_B1 [ rs_B2] alignment )
rounding function.
Ceil ( r_real [ r_base] )
- returns the smallest real
multiple of r_base exceeding r_real.
Ceil ( R_real [ r_base] )
- returns the rarray
of the smallest multiples of r_base exceeding components of the
input array R_real. Default r_base= 1.0 .
See also:
Floor( ).
crystallographic cell function.
Cell ( { os_ | m_map } )
- returns the rarray
with 6 cell parameters {a,b,c,alpha,beta,gamma} which were assigned to the
object or the map.
returns an rarray of partial electric charges of selected atoms,
or total charges for residue, molecule or objects, depending
on the selection level.
Charges can also be shown with a regular
show
as_select command.
Charge ( { os_ | ms_ | rs_ | as_ } [ formal | mmff ] )
- returns rarray of elementary or total charges
depending on the selection level.
- formal : return formal charges
- mmff : return formal charges calculated according to mmff atom types and rules. Note: do not confuse this option with a function to return the mmff charges.
Examples:
build string "ala his glu lys arg asp"
show Charge(a_1) # charge per molecule
show Charge( a_1/* ) # charge per residue
show Charge( a_1//* ) # charge per atom
avC=Charge(a_/5) # total electric charge of 15th residue
avC=Sum(Charge(a_/5/*)) # another way to calculate it
show Charge(a_//o*) # array of oxygen charges
# to return mmff charges:
set type mmff
set charge mmff
Charge( a_//* )
# to return total charges per molecular object:
read mol s_icmhome+"ex_mol.mol"
set type mmff
set charge mmff
Charge( a_*. )
See also:
set charge.
Chemical function. Converting and Generating library compounds. |
Converting 3D objects to chemical arrays.
Chemical( ms|os [exact] [hydrogen] [unique] [pharmacophore] )
returns an array of chemicals from a molecular selection of 3D molecular objects, e.g. a_H for hetero-molecules
By default the selected molecules will be converted to 2D graphs. However with
the exact option the original 3D coordinates will be retained in the elements of the chemical array.
If you want to preserve explicitly drawn hydrogens hydrogen option should be used.
Note that the number of chemicals in the array will be determined by the selection level. At the object
level multiple molecules of the same object will be merged into one array element.
With unique option duplicates will be excluded from the result.
Example:
read pdb "1ch8"
group table t_2D Chemical(a_H) # convert to 2D chemical table
group table t_3D Chemical(a_H exact) # convert to 3D chemical table
group table t_3D_hyd Chemical(a_H exact hydrogen) # convert to 3D chemical table and preserve hydrogens
With pharmacophore option the function generates pharmacophore points for the input selection.
Example:
read object s_icmhome + "biotin.ob" name="biotin"
read mol input = String( Chemical(a_ pharmacophore )) name="biotin_ph4"
display xstick
display wire a_biotin.
To display supported pharmacophore types and use show pharmacophore type command
Converting smiles to chemical arrays:
Chemical( S_smiles|s_smiles )
returns an array of chemicals from a string arrays of smiles.
Example:
add column t Chemical({"N[C@@](F)(C)C(=O)O", "C[C@H]1CCCCO1"})
See also: chemical functions
Generating combinatorial compounds from a Markush structure and R-group arrays.
Chemical( scaffold I_RgroupNumArray enumerate ) ⇒ returns one chemical
The I_RgroupNumArray is an array of as many elements as there are different R groups in the scaffold.E.g. if there is R1 R2 R3 than this parameter can be {10,21,8}. The numbers refer to the R-group arrays
linked to the scaffold.E.g.
group table scfld Chemical("C(=CC(=C(C1)[R2])[R1])C=1") "mol"
link group scfld.mol 1 Chemical({"N","O","S"})
link group scfld.mol 2 Chemical({"[Cl]", "[C*](=O)O"})
Nof( scfld.mol library ) # returns the total number of molecules in that combinatorial library
Nof( scfld.mol group ) # returns an array of sizes of each linked array in R1 R2.. order.
Chemical( scfld.mol {1 1} enumerate )
Chemical( scfld.mol {1 2} enumerate )
Chemical( scfld.mol {2 2} enumerate )
Chemical( enumerate scaffold [simple] R1 R2 ... ) ⇒ returns enumeration result
The same as above but does not require explicit linkage with link group command.
Example:
Chemical( enumerate Chemical("C(=CC(=C(C1)[R2])[R1])C=1") Chemical({"N","O","S"}) Chemical({"[Cl]", "[C*](=O)O"}) )
simple mode is similar to enumerate library and requires that size of R-group arrays be the same.
Example:
Chemical( enumerate Chemical("C(=CC(=C(C1)[R2])[R1])C=1") simple Chemical({"N","O"}) Chemical({"[Cl]", "[C*](=O)O"}) )
See also:
linking scaffold to R-group arrays and the Nof
[ Collection ]
Cluster( I_NxM_NearestNeighb i_M_totalNofNearNeighbors i_minNofCommonNeighbors ) ⇒ I_N_clusterNumbers
function returns iarray of cluster numbers for each or N points.
The input to the first function is an array of M nearest neighbors (defined
by the second argument i_M_totalNofNearNeighbors) for each of N points.
For example for an array for 5 points, and i_M_totalNofNearNeighbors = 3 it can be an array
like this: {3,4,5, 1,3,4 1,2,5 2,3,5 1,2,3} . The points will be grouped into
the same cluster if the number of neighbors they share is larger or equal than i_minNofCommonNeighbors .
This clustering algorithm is adaptive to the cluster density
and does not depend on absolute distance threshold. In other words it will identify both very sparse clusters
and very dense ones. The nearest neighbor array can be calculated by the
with the Link( I_bitkeys , nBits, nNearestNeighbors ) function.
Cluster( M_NxNdist r_maxDist ) ⇒ I_N_clusterNumbers
This function identifies the i_totalNofNeighbors nearest neighbors from the full
distance matrix M_NxNdist for each point and assembles points sharing
the specified number of common neighbors in clusters.
All singlets (a single item not in any cluster) are placed in a special cluster number 0 .
Other items are assigned to a cluster starting from 1.
Example with a distance matrix:
# let us make a distance matrix D
# we will cook it from 5 vectors {0. 0. 0.}
m=Matrix(5,3) # initialize 5 vectors
m[2,1:3]={1. 0. 0.} # v2
m[3,1:3]={1. 1. 0.} # v3
m[4,1:3]={1. 1. 1.} # v4
m[5,1:3]={1. 0.1 0.1} # v5 close to v2
D = Distance( m ) # 5x5 distance matrix created
Cluster( D , 0.2 ) # v2 and v5 are assigned to cluster 1
Cluster( D , 0.1 ) # radius too small. All items are singlets
Cluster( D , 2. ) # radius too large. All items are in cluster 1
Collection()
- returns empty collection object
Collection( s_json_string )
- returns a collection object from a text in JSON format
Collection( s_url_encoded_string )
- returns a collection object from a URL encoded string ("a=1&b=abc")
[ Color from gradient | Color image ]
returns RGB numbers.
Color ( g_grob )
- returns matrix of RGB numbers for each vertex of the g_grob (dimensions:
Nof ( g_grob),3).
See also: color grob matrix .
Example:
build string "se his"
display xstick
make grob image name="g_"
display g_ only smooth
M_clr = Color( g_ )
for i=1,20 # shineStyle = "color" makes it disappear completely
color g_ (1.-i/20.)*M_clr
endfor
color g_ M_clr
Color( M_rgb ) ⇒ S_colorNames
- returns sarray of color names approximating the rgb values in the matrix.
The color names and definitions are taken from the icm.clr file.
Example:
m = Matrix(3)
Color(m) # returns {"red","blue1","green"}
Color( system )
- returns sarray of system color names.
Color( system i_numColor )
- returns a name of a system color by number.
Example:
N = Nof( Color( system ))
for i=1,10
print Color( system Random(N) ) # randomly pick one color
endfor
Color( background )
- returns
rarray of three RGB components of the background color.
Interpolating colors by gradient |
Color( r_value s_gradient [ r_from r_to ] )
- returns 3-element rarray with RGB components describing the color.
Color( R_N_values s_gradient [ r_from r_to ] )
- returns matrix with N rows and 3 columns where each row is the
RGB representation of the interpolated color for the respective value in
the R_N_values array.
Examples:
s = "red/lime/blue"
Color( 0. s 0. 1. )
Color( 0.5 s 0. 1. )
Color( 1.0 s 0. 1. )
Color( 0.1 s 0. 1. )
Color( 0.8 s 0. 1. )
Color( {0.1 0.8} s 0. 1. )
Color( {1. 8.} s 0. 10. )
Color( 0.1 "red/lime/blue,0:1" )
Color( {0.1 0.8} "red/lime/blue,0:1" )
Color( {1. 8.} "red/lime/blue,0:10" )
Color( imageArray_ background )
returns sarray with background colors of the images in imageArray_.The color of the top left pixel of the image is returned as the background color currently.
See also: Image, image parray
Consensus ( ali_ ) ⇒ s_consensus
- returns the string consensus of alignment ali_.
The
consensus characters are these:
# hydrophobic; + RK; - DE; ^ ASGS; % FYW; ~ polar.
In the
selections by consensus
a letter code (h,o,n,s,p,a) is used.
Consensus ( ali_ { i_seq | seq_ } )
- returns the string
consensus of alignment ali_ as projected to the sequence.
Sequence can be specified by its order number in the alignment or by name.
Example displaying conserved residues:
read alignment "sx" # load alignment
read pdb "x" # structure
display ribbon
# multiply rs_ by a mask like " A C N .."
cnrv = a_/A & Replace(Consensus(sx cd59),"[.^~#]"," ")
display cnrv red
display residue label cnrv
linear correlation function (Pearson's coefficient R )
Corr ( R_X, R_Y ) ⇒ r_correlation
- returns the real value of the linear correlation coefficient.
Probability of the null hypothesis of zero correlation is stored in r_out .
Note: this function returns R , not R2 .
Taking it to the 2nd power can be a humbling experience.
Examples:
r=Corr(a,b) # two vectors a and b
if (Abs(r_out) < 0.3) print "it is actually as good as no correlation"
See also: LinearFit( ) function.
cosine function.
Arguments are assumed to be in degrees.
Cos ( { r_Angle | i_Angle } )
- returns the real
value of cosine of its real or integer argument.
Cos ( rarray )
- returns rarray
of cosines of each component of the array.
Examples:
show Cos(60.) # returns 0.5
show Cos(60) # the same
rho={3.2 1.4 2.3} # structure factors
phi={60. 30. 180.} # phases
show rho phi rho*Cos(phi) rho*Sin(phi) # show in columns rho, phi,
# Re, Im
hyperbolic cosine function.
Cosh ( { r_Angle | i_Angle } )
- returns the real value of hyperbolic cosine of its real or integer argument.
Cos(x)=0.5( eiz + e-iz )
Cosh ( rarray )
- returns rarray of hyperbolic cosines of each component of the array.
Examples:
show Cosh(1.) # 1.543081
show Cosh(1) # the same
show Cosh({-1., 0., 1.}) # returns {1.543081, 1., 1.543081}
function creates an iarray.
Count ( [ i_Min, ] i_Max )
- returns iarray of numbers growing from i_Min to i_Max.
The default value of i_Min is 1.
Examples:
show Count(-2,1) # returns {-2,-1,0,1}
show Count(4) # returns {1,2,3,4}
See also the Iarray( ).
Count ( array )
- returns iarray
of numbers growing from 1 to the number of elements in the array.
CubicRoot( r ) ⇒ r_cubic_root
CubicRoot( r [ r_im ] ) ⇒ R6_3re+3im
Example:
CubicRoot(27. )
3.
CubicRoot(27. 0.)
#>R
3.
-1.5
-1.5
0.
-2.598076
2.598076
Date( [i_nof] ) ⇒ e_currentDates
returns an date array of current system date and time.
Example:
print "Today is :" Date()
Date ( os_ ) ⇒ e_pdbDates
returns the date of the pdb file creation in an date array format.
The date read from the HEADER record of a pdb file and is stored with the object.
Example:
read pdb "1crn"
if Date(a_) > Date("1980","%Y") print "released after 1980"
Date ( {s_date|S_dates} [ s_format ] )
converts string or sarray to dates using s_format or default TOOLS.dateFormat
Example:
String( Date( "12 Oct 2002", "%d %b %Y" ) "%Y-%m-%d" )
The allowed format specifications are the following:
| format | description
|
|---|
| %a or %A | The weekday name according to the current locale, in abbreviated form or the full name.
| | %b or %B or %h | The month name according to the current locale, in abbreviated form or the full name.
| | %c | The date and time representation for the current locale.
| | %C | The century number (0-99).
| | %d or %e | The day of month (1-31).
| | %D | Equivalent to %m/%d/%y. (This is the American style date, very confusing to non-Americans, especially since %d/%m/%y is widely used in Europe.)
| | %H | The hour (0-23).
| | %I | The hour on a 12-hour clock (1-12).
| | %j | The day number in the year (1-366).
| | %m | The month number (1-12).
| | %M | The minute (0-59).
| | %n | Arbitrary whitespace.
| | %p | The locale’s equivalent of AM or PM. (Note: there may be none.)
| | %r | The 12-hour clock time (using the locale’s AM or PM). (%I:%M:%S %p)
| | %R | Equivalent to %H:%M.
| | %S | The second (0-60; 60 may occur for leap seconds; earlier also 61 was allowed).
| | %t | Arbitrary whitespace.
| | %T | Equivalent to %H:%M:%S.
| | %U | The week number with Sunday the first day of the week (0-53). The first Sunday of January is the first day of week 1.
| | %w | The weekday number (0-6) with Sunday = 0.
| | %W | The week number with Monday the first day of the week (0-53). The first Monday of January is the first day of week 1.
| | %x | The date, using the locale’s date format.
| | %X | The time, using the locale’s time format.
| | %y | The year within century (0-99). When a century is not otherwise specified, values in the range 69-99 refer to years in the twentieth century (1969-1999); values in the range 00-68 refer to years in the twenty-first century (2000-2068).
| | %Y | The year, including century (for example, 1991).
|
Example:
String( Date() "%b %d %Y %I:%M%p" ) # Current date and time in American style
String( Date() "%d/%b/%Y %H:%M" ) # European style
[ Decriptor ]
Deletion ( rs_Fragment, ali_Alignment [, seq_fromAli ] [, i_addFlanks ] [{"all"|"nter"|"cter"|"loop"}] )
- returns the residue selection
which flanks deletion points from the viewpoint of other sequences in the
ali_Alignment. If argument seq_fromAli is given (it must be the
name of a sequence from the alignment), all the other sequences in the alignment
will be ignored and only the pairwise sub-alignment of rs_Fragment and
seq_fromAli will be considered. The alignment must be
linked
to the object. With this function (see also Insertion function)
one can easily and quickly visualize and/or extract all indels
in the three-dimensional structure. The default i_addFlanks
parameter is 1. String options:
- "all" (default: no string option) select deletions of all types
- "nter" select only N-terminal fragments
- "cter" select only C-terminal fragments
- "loop" select only the internal zones of deleted loops
See example coming with the
Insertion( )
function description.
>>>Det{Det}
h3-- Det
determinant function.
Det ( matrix )
- returns a real determinant of specified square matrix.
Examples:
a=Rot({0. 0. 1.}, 30.) # Z-rotation matrix by 30 degrees
print Det(a) # naturally, it is equal to 1.
Solves the so called
"DIStance GEOmetry"
problem (finding coordinates from a distance set).
This function can be used to visualize in two or three dimensions a
distribution of homologous sequences:
group sequence se1 se2 se2 se4 mySeqs
align mySeqs
distMatr=Distances(mySeqs)
or any objects between which one can somehow define pairwise distances.
Since principal coordinates are sorted according to their
contribution to the distances and we can hardly visualize
distributions in more than three dimensions, the first two or
three coordinates give the best representation of how the
points are spread in n-1 dimensions. Another application is
restoring atomic coordinates from pairwise distances taken
from NMR experiments.
Disgeo ( matrix )
- returns matrix
[1:n,1:n] where the each row consists of n-1 coordinates of point
[i] sorted according to the eigenvalue (hence, their importance).
The first two columns, therefore, contain the two most significant
coordinates (say X and Y) for each of n points.
The last number in each row is the eigenvalue [i].
If distances are Euclidean, all the eigenvalues are positive or
equal to zero. The eigenvalue represents the "principal coordinate"
or "dimension" and the actual value is a fraction of data
variation due to the this particular dimension. Negative
eigenvalues represent "non-Euclidean error" in the initial distances.
- R_out returns four numbers: total negative eigen values, and the first 3 largest positive eigenvalues. All scaled to 100%.
Example:
read sequences s_icmhome+"zincFing" # read sequences from the file,
list sequences # see them, then ...
group sequence alZnFing # group them, then ...
align alZnFing # align them, then ...
a=Distance(alZnFing) # a matrix of pairwise distances
n=Nof(a) # number of points
b=Disgeo(a) # calculate principal components
corMat=b[1:n,1:n-1] # coordinate matrix [n,n-1] of n points
eigenV=b[1:n,n] # vector with n sorted eigenvalues
xplot= corMat[1:n,1]
yplot= corMat[1:n,2]
plot xplot yplot CIRCLE display # call plot a 2D distribution
[ Distance iarray | Distance rarray | Distance as_ | Distance as_ rarray | Distance matrix | Distance Tanimoto | Distance 2 matrices | Distance tether | Distance Dayhoff | Distance in alignment | Distance 2 alignments | Distance tree | Distance chemical ]
generic distance function.
Calculates distances between two ICM-shell objects, bit-strings or molecular objects, or
extracts distances from complex ICM-shell objects.
Distance( <I><I> | <R><R> | <as> <as> | <seq> <seq> ) => <r_dist>
Distance( <S|s>, <s>) => <R|r>
Distance( <ali> <ali> [exact] ) => <r>
Distance( <S> <S> [simple]) => M
Distance( <Mnk> ) => <Mnn>
Distance( <Mnk> <Mmk> ) => <Mnm>
Distance( <M_xyz>|<as> <M_xyz>|<as> <r_dist> ) => <l_yes_if_closer_than_dist>
Distance( <seq> <seq> [identity|evolution|new|fast|number|reverse] )
Distance( <seq> <seq> nucleotide [len] )
Distance( <seqArr[n]> ) => <M_nn>
Distance( <ali> <seq> [string] ) => R_n_seq_in_ali
Distance( <seqArr[n]> <seq> ) => <R_n>
Distance( <seqArr[n]> <seqArr[m]> ) => <M_nm>
Distance( <bitvecArr[n]> <bitvecArr[m]> ) => <M_nm> #tanimoto
Distance( <as_> [<r_default>=-1.] ) => <R_tether_lengths_or_def>
Distance( <as_n> <as_m> ) => d_between_centers_of_mass
Distance( <as_n> <as_m> all ) => R_nm
Distance( <as_n> <as_n> rarray ) => R_n: aligned arrays, same n
Distance( <ali> [0] ) => M_interSeqDist
Distance( <X_n> [<X_m>] ) => M_nxm_chemical_Tanimoto_distances
Distance( <I_keys1> <I_keys2> <i_nBits>|<R_nbitWeights> [simple] ) => M : Tanimoto|weighted
Distance( <tree> [<i_at>=1] split ) => <r_splitLevel>
Distance( <tree> all|modify ) => <R_splitLevels|splitLevelTStats>
Distance( <g> wire|grid [<i_maxDist(1000000)>] ) => <M_shortestPaths>
See detailed descriptions below.
Distance ( iarray1, iarray2 )
- returns the real sqrt of sum of (I1i -I2i )2 .
Distance ( R_X, R_Y )
- returns the real Cartesian distance between two vectors of the same length.
D = Sum( ( Xi - Yi )2 )
Distance ( as_1, as_2 [ all ] )
- returns the real distance in Angstroms between centers of mass of
the two specified selections. The interactive usage of this function:
Option all will return an array of all cross distances between the selections.
The selected virtual atoms will be skipped if the selection level residue, molecule or object.
Othewise, if you explicitly select virtual atoms, they will be included, e.g.
build string "ala" # contains 2 virtual atoms at N terminus
build string "his" # also contains 2 virtual atoms at N terminus
Distance( a_1. a_2. all ) # no virtual atom distances
Distance( a_1.// a_2.// all ) # selected virtual atoms are included
Distance( a_1. a_2. ) # a single distance between centers of mass
Distance ( as_1 , as_2, rarray )
- returns the rarray of distances in Angstroms between the two specified selections containing
the same number of atoms (1-1, 2-2, 3-3, ...).
See also: Distance ( as1 as2 all )
Distance ( M_coor )
- returns the square matrix
of distances between the rows of the input matrix M_coor.
Each row contains m coordinates (3 in 3D space). For example:
Distance(Xyz(a_//ca)) returns a square matrix of Ca-Ca distances.
Tanimoto distance between two arrays of bit-strings |
Distance( X_chem_n X_chem_m ) ⇒ M_nxm_distances
Distance( I_keys1 I_keys2 nBits | R_nBitWeights [simple] ) ⇒ M_distances
- returns the matrix of Tanimoto distances between two arrays of bit-strings.
Each array of N-strings is represented by an iarray I_keys of N*( nBits/32 )
elements (e.g. if nBits is 32 , each integer represents 1 bit-string,
if nBits i 64, I_keys1 has two integers for each bit string, etc.).
The returned matrix dimensions are N1 x N2 .
The distance is defined as 1. - similarity , where
The Tanimoto similarity between bitstrings is defined as follows:
The number of the on-bits in-common between two strings divided by the number of
the on-bits in either bit-string.
You can provide a relative weight for each bit in a bit-string as a rarray R_weights.
In this case the weighted Tanimoto distance is calculated as follows:
distWeighted = 1. - Sum( Wi_of_common_On_Bits ) / Sum( Wi_of_On_Bits )
With option simple the similarity calculation is modified so that
the number of bits in common is divided by the number of bits
in the second bit-string. For example:
Distance({3} {1} 32 simple ) # returns 0.
Distance({1} {3} 32 simple ) # returns 0.5
Example:
Distance({1 2 3},{1 2 3},32)
#>M
0. 1. 0.5
1. 0. 0.5
0.5 0.5 0.
The diagonal distances are 0; no bits are share between 1 (100..) and 2 (010..) (distance=1.) and
one of two bits is shared between 1 (100..) and 3 (110..).
Instead of the number of bits, one can provide the relative weights for each bit.
The dimension of the bit-weight array then becomes the size of the bit-string.
The weighted Tanimoto is calculated.
See also:
- Iarray-bits-to-integers{ Iarray({1 0 0 1 1 0 ..} key ) } to generate compressed integer bit vectors
Distance matrix between two sets of coordinates |
Distance ( M_coor1 M_coor2 )
- returns the matrix of distances between the rows of the two input matrices.
Each matrix row may contain any number of coordinates coordinates (3 in 3D space).
For example: Distance(Xyz(a_/1:5/ca) Xyz(a_/10:12/ca)
returns a 5 by 3 matrix of distances between Ca-s of the two fragments.
Distance( M_xyz1|as1 M_xyz2|as2 r_dist ) ⇒ l_yes_if_closer_than_dist
This function returns a logical yes if any two points or atoms in two sets of coordinates or selections are closer
than the threshold.
if Distance ( as1 as2 r_dist ) then ...
is a more efficient version of this condition:
if Nof( Sphere( as1 as2 r_dist )) > 0
Distance ( as_ [ r_defaultLength=-1.] )
- returns the real array of lengths of tethers for each selected atom or the default value ( -1. ).
The default value can be set to any value.
Tethers are assumed to be already set, see command set tether.
Also note, that the expression Distance( as_out )
will give the same results if as_out selection was not changed by
another operation; see also special selections.
Example:
read pdb "1crn"
convert tether # keeps tethers to the pdb original
deviations = Distance( a_//!h*,vt* , 9.9)
perResDevs = Group( deviations, a_//!h*,vt* ,"max") # find max.devs per residue
display ribbon
color ribbon a_/* perResDevs
# Another example
Distance( a_//T ) # selects only tethered atoms
#>R
1.677
1.493
1.386
1.435
1.645
1.570
2.165
1.399
|
|
Distance( seq1 seq2 [identity|evolution|new|fast|number|reverse] ) ⇒ r
Distance( seqArr[n] seq ) ⇒ R_n
- returns the real measure of similarity between two aligned sequences. Zero distance means
100% identity. The distance is calculated by the following two steps:
- d1 = 1.0 - (nResidueIdentities/Min(Length(Seq1), Length(Seq2))
(d1 belongs to [0.,1.] range)
- if there is no identity option the distance is corrected:
Distance(Seq1,Seq2) = DayhoffTransformation( d1 )
Transformation practically does not change small distances d1, whereas large
distances, especially above 0.9 (10% sequence identity) are increased to
take occasional reversals into account. Distances d1 within [0.9,1.0] are
transformed to [5.17, 10.] range.
Distance between sequences or alignment sequences |
Distance ( alignment )
Distance( seqArr[n] ) ⇒ M_nn
Distance( seqArr[n] seqArr[m] ) ⇒ M_nm
- returns matrix of pairwise sequence-sequence distances in the alignment.
These distances are calculated with the fast option as follows
1.-(nResidueIdentities-gapPenalty)/Min(Length(Seq1), Length(Seq2))
where gapPenalty is 3 for each gap.
Without the fast option the distances are calculated based on comparison matrix
and gap penalties. These distances are more sensitive but there is no simple
mapping between them and percent identity based distances.
Example:
read alignment msf s_icmhome+"azurins" # read azurins.msf
NormCoord = Disgeo(Distance(azurins)) # 2D sequence diversity in
Distance between two alignments |
Distance ( ali_1 ali_2 [ exact ] )
- returns the real distance between two alignments formed by the same sequences.
The distance is defined as a number of non-gap columns identical between
two alignments.
Two different normalizations are available:
The default normalization is to the shorter alignment. ( Distance ( ali_1 ali_2 ) ). In this case the number of equivalent pairs
is calculated and is divided by the total number of aligned pairs in the shorter
alignment.
This method detects alignment shifts but does not penalize un-alignment of previously aligned residue pairs.
D = (La_min - N_commonPairs)/La_min In the following alignment the residue pairs which are aligned in both alignments
are the same, therefore the distance is 0.
show a1 # La1 = 3
ABC---XYZ
ABCDEF---
show a2 # La2 = 6
ABCXYZ
ABCDEF
Distance(a1,a2) # a1 is a sub-alignment of a2, distance is 0.
0.
exact option: normalization to the number of pairs of the longer alignment. By longer we mean the larger number of aligned pairs regardless of alignment length
(the latter includes gaps and ends).
D = (La_max - N_commonPairs)/La_max Now in the above example, La_max = 6 , while N_commonPairs = 3, the distance is 0.5
(e.g. the alignments are 50% different).
Distance(a1,a2,exact) # returns 0.5 for the above a1 and a2
Example showing the influence of gap parameters:
read sequence msf s_icmhome+"azurins.msf"
gapOpen =2.2
a=Align(Azu2_Metj Azup_Alcfa) # the first alignment
gapOpen =1.9 # smaller gap penalty and ..
b=Align(Azu2_Metj Azup_Alcfa) # the alignment changes
show 100*Distance(a b ) # 20% difference
show 100*Distance(a b exact ) # 21.7% difference
show a b
The distance of the cluster splitting level |
Distance( treeArr i_at separator )
- return the current value of the cluster splitting level set by split command.
Chemical similarity distance |
Distance( chemarray )
- return square matrix of chemical distances. The chemical distance is
defined as the Tanimoto distance between binary fingerprints
Example:
Distance( Chemical( { "CCC", "CCO"} ) )
Distance( chemarray1 chemarray2 )
- return a MxN matrix where M is number of elements in chemarray1 and
N is number of elements in chemarray2
Example:
Distance( Chemical({ "CCC", "CCO"}) Chemical("CC" ))
See also: find table find molcart other chemical functions
eigenvalues/eigenvectors function.
Eigen ( M_ )
- returns the square matrix ( n x n ) of eigenvector columns of the input symmetric square matrix
M_ . All n eigenvalues sorted by their values are stored in the R_out rarray.
Example:
A = Matrix(3, 3, 0.) # create a zero square matrix...
A[1:3,1] = {1.,-2.,-1.} # and set its elements
A[2,2] = 4.
for i = 1, 3-1 # the matrix must be symmetric
for j = i+1, 3
A[i,j] = A[j,i]
endfor
endfor
X = Eigen(A) # calculate eigenvectors...
V = R_out # and save eigenvalues in rarray V
printf "eigenvalue 1 eigenvalue 2 eigenvalue 3\n"
printf "%12.3f %12.3f %12.3f\n", V[1], V[2], V[3]
printf "eigenvector1 eigenvector2 eigenvector3\n"
for i = 1, 3
printf "%12.3f %12.3f %12.3f\n", X[i,1], X[i,2], X[i,3]
endfor
function.
Energy ( string )
- returns the real sum of pre-calculated energy and penalty (i.e. geometrical restraints)
terms specified by the string.
Important: this function does NOT calculate the energy,
the terms must be calculated beforehand by invoking one of the
following commands where energy is calculated at least once:
show energy,
minimize,
ssearch command and
montecarlo command.
Note:
- Allowed terms in the string are "vw,14,hb,el,to,af,bb,bs,cn,tz,rs,xr,sf";
- "func" stands for the total of all the terms, both energy and penalty;
- "ener" is only the energy part (i.e. "vw,14,hb,3l,to,af,bb,bs,sf" );
- "pnlt" is only the penalty part (i.e. "cn,tz,rs,xr" ).
-
load conf
and
load frame
commands fill out all the energy/penalty terms, which are stored in
both stacks and trajectory files (of course the values also depend on a set of
free variables).
You can get the energy/penalty terms of the loaded conformation
without explicitly recalculating them.
Examples:
read object s_icmhome+"dcLoop.ob"
show energy
print Energy("vw,14,hb,el,to") # ECEPP energy
read stack s_icmhome+"dcLoop.cnf"
load conf 0
print Energy("func") # extract the best energy without recalculating it
Energy ( rs_ [ simple | base | s_energyTerms ] )
- in contrast to the previous function this function with an explicit residue selection
calculates and returns residue energies in an ICM object. convert the object if is not
of the ICM type.
The energies are calculated according to the current energy terms ,
and also depend on the fixation of the object.
Use unfix only V_//S to restore standard fixation.
This function can be used to evaluate normalized residue energies for standard amino-acids
to detect local problems in a model.
For normalized energies, use the simple option.
The base option just shifts the energy value to the
mean energy for this residue type.
If the simple or base terms are not used, the
current energy terms are preserved.
The energies calculated with the simple or base option
are calculated with the "vw,14,hb,el,to,en,sf" terms.
The terms are temporarily enforced
as well as the vwMethod = 2 and vwSoftMaxEnergy values, so that
the normalization performed with the simple option is always correct.
This function will calculate residue energies for all terms and set-ups with the following exceptions:
- electrostatic ( "el" ) term and electroMethod = "boundary element", "MIMEL", or "generalized Born"
The s_energyTerms argument allows to refine the energy terms dynamically (see example below).
Example:
read pdb "1crn"
delete a_W
convert
set terms "vw,14,hb,el,to,en,sf"
group table t Energy( a_/A ) "energy" Label(a_/A ) "res"
show t
unfix V_//*
group table tBondsAngles Energy( a_/A "bs,bb" ) "covalent" Label(a_/A ) "res"
show tBondsAngles
See also: the calcEnergyStrain macro.
Energy ( conf i_confNumber)
- returns the table of all the energy components for a given stack conformations.
The table has two arrays:
-
sarray of the energy term names ( .hd ) and
-
rarray of energy values for each energy term ( .ey ) and
Energy ({ stack | conf } )
- returns the rarray of total energies of stack conformations.
Useful for comparison of spectra from different simulations.
Examples:
read object s_icmhome+"crn.ob"
set terms only "vw,14,hb,el,to" # set energy terms
show energy v_//xi* # calculate energy with only
# side chain torsions unfixed
# energy depends on what variables are fixed since
# interactions inside rigid bodies are not calculated,
# and rigid body structure depends on variables
a = Energy("vw,14") # a is equal to the sum of two terms
electroMethod="MIMEL" # MIMEL electrostatics
set terms only "el,sf" # set energy terms
show energy
print Energy("ener") # total energy
print Energy("sf") # only the surface part of the solvation energy
print Energy("el") # electrostatic energy
print r_out # electrostatic part of the solvation energy
function
indicates that the previous ICM-shell command has completed with error.
Error
- returns logical yes if there was an error in a previous command
(not necessarily in the last one).
After this call the internal error flag is reinstalled to no.
The shell error flag can be set to yes with the set error command.
Error ( string )
- returns string with the last error message.
It also returns integer code of the last error in your script in i_out .
In contrast to the logical Error() function,
here the internal error code is not reinstalled to 0, so that you can
use it in expressions like if( Error ) print Error(string) .
Error ( i_error_or_warning_code ) ⇒ l
Error ( number ) ⇒ s
- returns logical yes if an error or warning with the specified code occurred
previously in the script. This call also resets the flag (e.g. Error(415) ).
This is convenient to track down certain warnings or errors in scripts (e.g. detecting
if 'readpdb{read pdb} found certain problems).
Option number will return a string will previously set error and warning messages.
To clear all bits use the clear error command.
Examples:
read pdb "1mng" # this file contains strange 28-th residue
if (Error) print "These alternative positions will kill me"
read pdb "1abcd" # file does not exist
read pdb "1mok"
clear error
See also:
errorAction , s_skipMessages , l_warn, Warning
Error ( r_x [ reverse ] )
- returns real complementary error function of real x : erfc(x)=1.-erf(x)) ,
defined as
(2/sqrt(pi)) integral{x to infinity} of exp(-t2) dt
or its inverse function if the option reverse is specified.
It gives the probability of a normally distributed (with mean 0. and
standard deviation 1./Sqrt(2.)) value to be larger than r_x
or smaller than -r_x.
Examples:
show 1.-Error(Sqrt(0.5)) # P of being inside +-sigma (about 68%)
show Error(2.*Sqrt(0.5)) # P of being outside +- 2 sigma
Error ( R_x )
- returns rarray of erfc(x)=1.-erf(x)) functions for each element of the real array
(see above).
Examples:
x=Rarray(1000 0. 5. )
plot display x Error(x ) {0. 5. 1. 1. 0. 1. 0.1 0.2 }
plot display x Log(Error(x ),10.) {0. 5. 1. 1.}
#NB: can be approximated by a parabola
#to deduce the appr. inverse function.
#Used for the Seq.ID probabilities.
Error (for SOAP messages) |
Error( soapMessage )
- returns a error string from the SOAP message. (empty string if no error)
This function is used the check the result of calling SOAP method.
See: SOAP services for more details and examples.
[ Exist-pattern | Exist molcart ]
function indicates if an ICM-entity exists or not.
Exist ( s_fileName [ write | read | directory ] )
- returns logical yes if the specified file or directory exists, no otherwise.
Options:
- write open for writing
- read open for reading
- directory the provided string is a directory (not file)
Exist ( key, s_keyName )
- returns logical yes if the specified keystroke has been previously defined. Examples:
Exist(key, "F1" , Exist( key, "Ctrl-B" )
See also: set key command.
Exist ( object )
- returns logical yes if there is at least one molecular object in the shell, no otherwise.
Exist ( os1 stack )
- returns logical yes if there is a built-in object stack , no otherwise.
Exist ( box )
- returns logical yes if the purple boxis displayed, no otherwise.
Exist ( view )
- returns logical yes if the GL - graphics window is activated, no otherwise.
Exist ( gui )
- returns logical yes if the GRAPHICS USER INTERFACE menus is activated, no otherwise.
Exist ( grob display )
- returns logical yes if the grob is displayed.
Exist( connect )
- returns logical yes if the mouse rotations are connected to a graphical object ( grob ) or a molecular object.
Exist( s_table_name sql table )
- returns logical yes if there is an sql table with the specified name exists. It works with the Molcart tables or
tables accessed via the Sql function.
Exist( variable s_varName )
- returns yes if the variable exists in the ICM shell, no otherwise. See also Type( ). E.g.
Exist(variable, "aaa") # returns no
aaa=234
Exist(variable, "aaa") # returns yes
Examples:
if (!Exist("/data/pdb/") then
unix mkdir /data/pdb
endif
if(!Exist(key,"Ctrl-B")) set key "Ctrl-B" "l_easyRotate=!l_easyRotate"
if !Exist(gui) gui simple
Exist( chemarray pattern )
returns logical yes if at least one of the elements contains SMARTS search attributes, no - otherwise.
Example:
Exist( Chemical("[C&H1,N]") pattern ) # returns yes
Exist( Chemical("CCO") pattern ) # return no
Exist( s_dbtable sql table )
- returns logical yes if the specified table exists in the database
See also: molcart
function indicating if an UNIX-shell environmental variable exists.
Existenv ( s_environmentName )
- returns
logical yes if the specified named environment
variable exists.
Example:
if(Existenv("ICMPDB")) s_pdb=Getenv("ICMPDB")
See also: Getenv( ), Putenv( ) .
function.
Extension ( string [ dot ] )
- returns string which would be the extension if the string is a file name.
Option dot indicates that the dot is excluded from the extension.
Extension ( sarray [ dot ] )
- returns sarray of extensions.
Option dot indicates that the dot is excluded from the extensions.
Examples:
print Extension("aaa.bbb.dd.eee") # returns ".eee"
show Extension({"aa.bb","122.22"} dot) # returns {"bb","22"}
read sarray "filelist"
if (Extension(filelist[4])==".pdb") read pdb filelist[4]
exponential mathematical function (ex).
Exp ( real )
- returns the real exponent.
Exp ( rarray )
- returns rarray
of exponents of rarray components.
Exp ( matrix )
- returns matrix
of exponents of matrix elements.
Examples:
print Exp(deltaE/(Boltzmann*temperature)) # probability
print Exp({1. 2.}) # returns { E, E squared }
[ Field user ]
function.
Field ( s_ [ s_precedingString] i_fieldNumber [ s_fieldDelimiter] )
- returns the specified field. Parameter s_fieldDelimiter
defines the separating characters (space and tabs by default). If the field number
is less than zero or more than the actual number of fields in this string,
the function returns an empty string.
The s_fieldDelimiter string
Single character delimiter can be specified directly, e.g.
Field("a b c",3," ") # space
Field("a:b:c",3,":") # colon
Alternative characters can be specified sequentially, e.g.
Field("a%b:c",3,"%:") # percent OR colon
Multiple occurrence of a delimiting character can be specified by
repeating the same character two times, e.g.
Field("a b c",3," ") # two==multiple spaces in field delim
Field("a%b::::c",3,"%::") # a single percent or multiple colons
You can combine a single-character delimiters and multiple delimiters in one
s_fieldDelimiter string.
More examples:
s=Field("1 ener glu 1.5.",3) # returns "glu"
show Field("aaa:bbb",2,":") # returns "bbb"
show Field("aaa 12\nbbb 13","bbb",1) # returns "13"
show Field("aaa 12\nbbb 13 14","bbb",2," \n\n") # two spaces and two \n .
# another example
read object s_icmhome+"all"
# energies from the object comments, the 1st field after 'vacuum'
show Rarray(Field(Namex(a_*.),"vacuum",1))
Field ( S_ , [ s_precedingString] i_fieldNumber [ s_fieldDelimiter] )
- returns an string array of fields selected from S_ string array .
s_fieldDelimiter is the delimiter. If the field number is less than
zero or more than the actual number of fields in this string, an element of the
array will be an empty string.
Examples:
show Field({"a:b","d:e"},2,":") # returns {"b","e"}
s=Field({"aa 2 3.3", "bb 4 1.3", "cc 31a 1.1 3"},2)
# returns {"2","4","31a"}
s=Field({"aa 2 3.3", "bb 4 1.3", "cc 31a 1.1 3"},4)
# returns {"","","3"}
See also: Split( ).
User field from a selection |
Field( as_ [s_fieldName] )
Field( { rs_ | ms_ | os_ } [ i_fieldNumber ] )
Field( os_ 15 )
returns rarray of user-defined field values of a selection.
Some fields are filled upon reading a pdb file
Atoms. Only one user defined field can be set to atoms, e.g.
read object s_icmhome+"crn.ob"
set field a_//* Random(0.,1.,Nof(a_//*))
show Field( a_//* )
read pdb "1f88" # rhodopsin, many loops missing
Field( a_ 15) # returns 31. residues
Residues, molecules and objects.
Three user fields can be defined for each residue and up to 16 for molecules and objects.
To extract them specify i_fieldNumber . The level of the selection determines
if the values are extracted from residues, molecules or objects. Use the selection level functions
Res Mol and Obj to reset the level if needed. For example: Res(Sphere(gg, a_1. 3.))
selects residues of the 1st object which are closer than 3. A to grob gg .
Upon reading a pdb file the object field 15 contains the number of residues missing from
the ATOM records, but present in SEQRES records due to local disorder.
Example:
read object s_icmhome+"crn.ob"
set field a_/A Random(0.,1.,Nof(a_/A)) number = 2 # set the 2nd field to random values
color a_/* Field( a_/A 2 ) # color by it
See also:
- set field as_ .. ,
- Smooth rs_ to generate 3D-averaged user fields
- Select function to select by user defined field (e.g. Select( a_// "x>-1." ) ).
function returning file names or attributes of named files.
File ( os_ )
returns the name of the source file for this object. If the object
was created in ICM or did not come from an object or PDB file, it
returns an empty string.
Example:
read pdb "/home/nerd/secret/hiv.ob"
File( a_ )
/home/nerd/secret/hiv.ob
File ( s_file_or_dir_Name "length" )
- returns integer file size or -1.
File ( s_file_or_dir_Name "time" )
- returns integer modification time or -1. Useful if you want to compare which of two files is newer.
File ( icm_object )
- returns string file name from which this object has been loaded or empty string.
File ( s_file_or_dir_Name )
- returns string with the file or directory attributes separated by space.
Note that this function will only work on Unix or Mac, see a`Exist ( s_file .. ) function for cross-platform functions.
If file or directory do not exist the function returns "- - - - 0" Otherwise,
it contains the following 4 characters separated by space and the file size:
- type character:
- 'f' - regular file
- 'd' - directory
- 'l' - symbolic link
- 'c' - character special file
- 'p' - pipe
- 'r' if you can read the file (or from the directory)
- 'w' if you can write to this file (or directory)
- 'x' if you can execute this file (or cd to this directory)
- file size in bytes
To get a string with any field use Field(File( s_name), i_fieldNumber) .
To get the size, use Integer(Field(File( s_name),5)).
Example:
if File("/opt/icm/icm.rst")=="- - - - 0" print "No such file"
if Field(File("PDB.tab"),2)!= "w" print "can not write"
if ( Indexx( File("/home/bob/icm/") , "d ? w x *" ) ) then
print "It is indeed a directory to which I can write"
endif
# Here the Indexx function matched the pattern.
if ( Integer(Field(File(s_name),5)) < 10 ) return error "File is too small"
File ( last )
returns the file name of the last icm-shell script called by ICM.
In scripts File(last) can be used for the Help section.
See also: Path ( last )
File ( T_IndexTable database )
returns the file name of the first source file indexed.
Example:
read index "nci"
File( nci database)
/data/chem/nci.sdf
[ Find in array | Find in table | Find chemical ]
function searching all fields (arrays) of a table.
Find closest value in array |
Find ( R_source r_value )
Find ( I_source i_value )
- returns index of the source array element which is closest to the value
Example:
Find( {10 20 30 40 50} 43 ) #will return 4 because 40 is the closest value
Find( {1. 2. 3.} 100. ) #will return 3
See also: Index
Find ( table s_searchWords )
- returns table containing the entries matching all the words given in the
s_searchWords string.
If s_searchWords is "word1 word2" and table contains arrays a and b
this "all text search" is equivalent to the expression :
(t.a=="word1" | t.b == "word1") & (t.a=="word2" | t.b == "word2").
Examples:
read database "ref.db" # database of references
group table ref $s_out # group created arrays into a table
show Find(ref,"energy profile") & ref.authors == "frishman"
Find ( table s_pattern regexp )
- returns table containing the entries where at least one text column matches s_pattern.
Examples:
add column t { "one" "two" "three" } {"Item1", "Item2" "Item3" }
Find( t "Item[12]" regexp ) # matches first two rows
Find( t "two|three" regexp ) # matches last two rows
Find chemical substructures. |
Find( mol_array, array_of_chemical_patterns S_labels )
Find( mol_array, table_with_chemical_patterns )
returns a 'sarray of chemical-pattern labels found in the mol_array.
If the table argument is provided as the source of the chemical patterns, the function will look for two columns:
- .mol array of chemical patterns
- a column called ".LABEL" or ".LABELS" in either upper or lower case.
The patterns can be specified using the wild cards permitted by the Molsoft chemical editor.
Example:
Find( chemTable.mol, Chemical( {"c1ccccc1", "[CH3]"} ), {"benzene", "methyl"} )
# or
group table t Chemical( {"c1ccccc1", "[CH3]"} ) "mol" {"benzene", "methyl"} "label"
Find( chemTable.mol, t )
See also: Index chemical Nof find table find molcart
rounding function.
Floor ( r_real [ r_base ] )
- returns the largest
real
multiple of r_base not exceeding r_real.
Floor ( R_real [ r_base] )
- returns the
rarray
of the largest multiples of r_base not exceeding components of the
input array R_real.
Default r_base= 1.0 .
See also: Ceil( ).
Formula( chem-array )
- returns the sarray of compounds' molecular formulas.
function returning the value for an argument to ICM or an icm-script.
If one runs icm directly, specify arguments after the -a option,
e.g.
icm -s -a t=2 verbose c='some text' # three arguments passed to icm
icm_script t=2 verbose c='some text' # three arguments passed to icm_script
Getarg ( s_icmargName [s_default] [ delete ] )
Getarg ( s_int_argName [i_default] [ delete ] )
Getarg ( s_real_argName [r_default] [ delete ] )
Getarg ( s_log_argName [l_default] [ delete ] )
If the default value is provided, the returned object is cast to default value's type.
Else the function tries to guess the return type based on the value format.
If the default value is of logical type, the function returns the opposite value
if the argument is found in the list. e.g. Getarg("-x",yes) will return
no if the option was specified).
for icm or icm-script arguments like name returns a string with "yes".
For argument name=value returns the argument value converted according
to the default value.
The default value is be returned if the argument is not specified.
Option delete extracts the variable from the list.
Getarg( )
returns a concatenated list (`string) of all arguments prepared for interpretation
by a Unix shell. This is convenient for passing arguments further to
a nested script. Trim(Getarg(),all) will return the empty string if no arguments are found.
Getarg( list [delete] )
returns sarray of non-option arguments (usually they are file names).
Getarg( name )
returns sarray of arugment names
Getarg( set )
returns sarray of arugment values
Getarg( delete )
deletes all arguments and returns the number of them
Testing if the argument exists Getarg( s_argName [find|test] )
returns yes if the argument can be found in the list in any form.
Getarg( s_argName [name] )
returns yes if the argument is in the list as the name only (rather than the
name=value pair). E.g. -verbose will return yes, and -verbose=2.3
will return no.
Getarg ( i_pos gui )
returns string which contain a user input after GUI dialog execution using Askg function.
Examples :
if Getarg("-L" find) print "-L was found"
t = Getarg("time","1.",delete)
s = Getarg("sequence","ABC")
Getarg("-L" yes ) # returns no in this case, yes is the default
Getarg("-L" no ) # returns yes since no was the default
args = Getarg(name)
wrongArgs = NotInList({"s","t"} ,args)
if wrongArgs print " error> illegal arguments ", Sum(wrongArgs)
The example above may be called from the shell like:
> icm -a time=1.5 sequence="ADEGFKL" -L file1 file2
An example with an icm script:
> cat script.icm
#!icm -s
x=Getarg("x","3")
y=Getarg("y","a b c")
show x,y
> script.icm x=33 y="d e"
33, "d e"
An example of dialog input:
buf = "#dialog{\"Select InSilco Models\"}\n"
buf += "#1 s_Some_Input (some text)\n"
buf += "#2 l_Check (no)\n"
buf += "#3 i_Number (4)\n"
Askg( buf ) # run the dialog
print Getarg( 1 gui ) Getarg( 2 gui ) Getarg( 3 gui )
Another example with a text box txw_ spec :
#dialog{ "Sample Dialog" }
# txw_Enter_Text ()
txt = %s_out # s_out is not a safe place (might be overwritten)
print Length(txt)
See also Putarg , Getenv, script .
function returning value for an environment name.
Getenv ( s_environmentName [s_default] )
- returns a string of the value of the named environment variable.
If the default string is provided, it is used if the variable is not found.
Example:
user = Getenv("USER") # extract user's name from the environment
if (user=="vogt") print "Hi, Gerhard"
Getenv("HOME","you are homeless :-(") # use default if HOME is not found
/home/ruben/
Getenv("HOME_MISSPELLED","you are homeless :-(")
you are homeless :-(
Getenv("HOME_MISSPELLED") # error
See also:
Existenv( ), Putenv( ) .
function.
Gradient( )
- returns the real value of the root-mean-square gradient
over free internal variables.
Gradient ( vs_var )
- returns the rarray
of pre-calculated energy derivatives with respect to specified variables.
Gradient ( as_ | rs_ )
- returns the rarray of
pre-calculated energy derivatives with respect to atom positions
(G[i] = Sqrt(Gxi*Gxi+Gyi*Gyi+Gzi*Gzi))
The function returns atom-gradients for atom selection ( as_ ) or
average gradient per selected residue, if residue selection is specified ( rs_ ).
You can display the actual vectors/"forces" (-Gxi, -Gyi, -Gzi) by the
display gradient
command.
Important: to use the function, the gradient must be pre-calculated
by one of the following commands:
show energy,
show gradient,
minimize .
Example:
read object s_icmhome+"crn.ob"
show energy # to calculate the gradient and its components
if (Gradient( ) > 10.) minimize
show Max(Gradient(a_//c*) # show maximum "force" applied to the carbon atoms
[ Grob-select-by-color ]
function to generate graphics objects.
Grob ( "arrow", { R_3 | R_6 } )
- returns grob containing 3D wire arrow between either 0.,0.,0. and R_3, or
between R_6[1:3] and R_6[4:6].
Grob ( "ARROW", { R_3 | R_6 } )
- returns
grob
containing 3D solid arrow. You may specify the number of faces
by adding integer to the string: e.g. "ARROW15" (rugged arrow) or
"ARROW200" (smooth arrow).
See also:
GROB.relArrowSize.
Examples:
GROB.relArrowSize = 0.1
g_arr = Grob("arrow",Box( )) # return arrow between corners of displayed box
display g_arr red # display the arrow
g_arr1 = Grob("ARROW100",{1. 1. 1.})
display g_arr1
Grob ( "cell", { R_3 | R_6 } )
- returns
grob
containing a wire parallelepiped for a given cell.
If only R_3 is given, angles 90.,90.,90. are implied.
Grob ( "CELL", { R_3 | R_6 } )
- returns grob
containing a solid parallelepiped for a given cell.
If only R_3 is given, angles 90.,90.,90. are implied.
Example:
read csd "qfuran"
gcell = Grob("CELL",Cell( ) ) # solid cell
display a_//* gcell transparent # fancy stuff
Grob ( "distance", as_1 [ as_2 ] )
- returns grob with the distance lines. This grob can be displayed
with distance labels (controlled with the GRAPHICS.displayLineLabels parameter).
With one selection it returns all possible interatomic distances within this
selection. If two selections are provided, the distances between the atoms of
the two sets are returned.
Example:
build string "se ala his trp"
g = Grob( "distance", a_/1/ca a_/2/ca )
display g
GRAPHICS.displayLineLabels = no
display new
Grob ( "label", R_3, s_string )
- returns grob containing a point at R_3 and a string label.
Grob ( "line", R_3N )
- returns grob
containing a polyline R_3N[1:3], R_3N[4:6], ...
Example:
display a_crn.//ca,c,n
g = Grob("line",{0.,0.,0.,5.,5.,5.}) # a simple line (just as an example)
display g yellow
gCa = Grob("line",Rarray(Xyz(a_//ca))) # connect Cas with lines
display gCa pink # display the grobs
Grob ( "SPHERE", r_radius i_tesselationNum )
- returns grob containing a solid sphere. The i_tesselationNum parameter may be 1,2,3..
(do not go too high).
Example:
display a_crn.//ca,c,n
# make grob and translate to a_/5/ca
# Sum converts Matrix 1x3 into a vector
g=Grob("SPHERE",5.,2)+Sum(Xyz(a_/5/ca))
# mark it with dblLeftClick and
# play with Alt-X, Alt-Q and Alt-W
display g red
Grob ( "torus", r_radius r_radius2 [i_quality] )
- returns grob containing a solid torus.
Grob ( "ellipsoid", r_radius r_radius2 [i_quality] )
- returns grob containing a solid ellipsoid.
Grob ( "cylinder", r_radius r_height [i_quality] )
- returns grob containing a solid cylinder.
Example
t = Grob("torus", 1.2 0.2 )
e = Grob("ellipsoid" 1 0.4 )
display smooth t red
display smooth e blue
Grob( grob R_6rgbLimits )
returns a grob containing selection of vertices of the source grob.
The vertices with colors between the RGB values provided in the
6-dim. array of limits will be selected. The array of limits consists
of real numbers between 0. and 1. :
{ from_R, to_R, from_G, to_G, from_B, to_B }
If you want a limit to be outside possible
rgb values, use negative numbers of numbers larger than 1., e.g.
a selection for the red color could be: {0.9,1.,-0.1,0.1,-0.1,0.1}
The grob created by this operation has a limited use and will contain only vertices
(no edges or triangles).
This form of the Grob function can be used to find out which atoms or residues are
located to spots of certain color using the Sphere( grob as_ ) function.
Example:
build string IcmSequence("ADERD") # a peptide
dsRebel a_ no no
g=Grob(g_electro_def_ {0.9,1.,-0.1,0.1,-0.1,0.1} ) # red color
display g_electro_def_ transparent
display g
show Res(Sphere( g, a_//* 1.5))
See also: color grob by atom selection, and GROB.atomSphereRadius .
Group ( R_atomArray as_atomSelection "min"|"max"|"avg"|"rms"|"sum"|"first" ) ⇒ rarray
Group ( I_atomArray as_atomSelection "min"|"max"|"avg"|"sum"|"first" ) ⇒ iarray
Group ( as_atomSelection "count" ) ⇒ iarray
returns an array of atoms properties aggregated to a per-residue array.
One of the following functions can be applied to the atomic values:
- "min" - stores the minimal atomic property for each selected residue
- "max" - stores the maximal atomic property for each selected residue
- "avg" - (syn. "mean") stores the mean of properties for each selected residue
- "rms" - stores the root-mean-square deviation of properties for each selected residue
- "sum" - stores the sum of properties for each selected residue
- "first" - stores the property of the first atom in selected residue
- "count" - stores the number of selected atoms in selected residue
The function name is case-insensitive (you may use "Min" or "MIN").
Example:
read pdb "1crn"
show Group( a_A//* "count" ) # numbers of atoms in residues
show Group( Mass( a_A//* ) , a_A//* "sum" ) # residue masses
show Group( Mass( a_A//* ) , a_A//* "rms" ) # residue mass rmsd
Header ( os_ )
returns sarray with the PDB entry information stored in the requested objects.
PDB entry information is stored in objects in HTML format. Use Header( os1_ )[1] for a single string.
In order to be able to access the additional information in the objects' header,
they should be read from PDB using the read pdb command with the header option.
Notice that if the object was read with the read pdb html option the header will be in html format,
while it if the header option was used instead, the entire header will be stored as is.
Example:
read pdb "1crn" html
h1 = Header( a_1crn. )[1]
set property h1 html
See also read pdb .
function to create a histogram of an array.
Function returns
matrix [ n,2], where n is number of cells, the first row contains a number
of elements in each cell and the second row contains mid-points of each cell.
Histogram (I_inputArray )
- returns matrix with a histogram of the input array.
Histogram ( R_inputArray, i_numberOfCells [, R_weights ] )
- returns histogram matrix [ i_numberOfCells,2] in which the whole range of the R_inputArray
array is equally divided in i_numberOfCells windows. An array of point weights can be provided.
Histogram ( R_inputArray, r_cellSize)
- returns matrix [ n ,2], dividing the whole range of R_inputArray equally into r_cellSize windows.
Histogram ( R_inputArray, r_from, r_to, r_cellSize )
- returns matrix
[ n,2], dividing into equal cells of r_cellSize
between minimum value, maximum value.
Histogram ( R_inputArray, R_cellRuler [, R_weights ] )
- returns matrix [ n,2],
dividing the range of the input array according to the R_cellRuler
array, which must be monotonous. An array of R_weights of the same
size as the input array can be provided.
Examples:
plot display Histogram({ -2, -2, 3, 10, 3, 4, -2, 7, 5, 7, 5}) BAR
a=Random(0. 100. 10000)
u=Histogram(a 50)
s_legend={"Histogram at linear sampling curve" "Random value" "N"}
plot display regression BAR u s_legend
a=Random(0. 100. 10000)
b=.04*(Count(1 50)*Count(1 50))
u=Histogram(a b)
s_legend={"Histogram at square sampling curve" "Random value" "N"}
plot display BAR u s_legend
b=Sqrt(100.*Count(1 100))
s_legend={"Histogram at square root sampling curve" "Random value" "N"}
plot display green BAR Histogram(a b) s_legend
[ Iarray making | Iarray inverse | Iarray bits to integers | Iarray atom numbers | Iarray residue numbers | Iarray stack ]
function to create/declare an empty iarray or transform to an iarray.
Summary:
Iarray( [i_n=0 [i_default=0]] )
Iarray( R|S|I ) ⇒ I
Iarray( I reverse ) ⇒ I_reverseOrder
Iarray( I key ) ⇒ I_compress01intoInts # obsolete
Iarray( stack ) ⇒ I_nofVisits
Iarray( as ) ⇒ I_atomCodes
Iarray( as topology ) ⇒ I_atomSymmetryNumbers
Iarray( rs|ms|os ) ⇒ I_nAtomsInEachRes|Mol|Obj
Creating or converting into an iarray |
Iarray ( i_NumberOfElements [ i_value ] )
- returns iarray of i_NumberOfElements elements set to i_value or zero.
You can also create an zero-size integer array: Iarray(0) .
Iarray ( rarray )
- returns iarray of integers nearest to real array elements in the direction
of the prevailing rounding mode magnitude of the real argument.
Iarray ( sarray )
- converts sarray into an iarray.
Examples:
a=Iarray(5) # returns {0 0 0 0 0}
a=Iarray(5,3) # returns {3 3 3 3 3}
b=Iarray({2.1, -4.3, 3.6}) # returns {2, -4, 4}
c=Iarray({"2", "-4.3", "3.6"}) # returns {2, -5, 3}
Reversing the order of elements in an integer array. |
Iarray ( iarray reverse )
- converts input real array into an iarray with the reversed order of elements.
Example:
Iarray({1 2 3} reverse) # returns {3 2 1}
See also: Sarray( S_ reverse ), Rarray( S_ reverse ), String(0,1,s)
Generating a compressed integer bit vector for Tanimoto calculations. |
Iarray( I_nBitVector key )
- returns a shorter vector of integers if n/32 elements, in which every 32 array values
of zeros and non-zeroes are compressed into one integer. The number of elements n does not need
to be a multiple of 32, the missing elements will be assumed to be zero.
Example:
Iarray({1 0 1 0 0 0 0},key) # returns {5}
Iarray({1 1 1 0 0 0 0},key) # returns {7}
See also:
- Distance ( I_n I_n nBits key ) => M_nxm_Tanimotos
Iarray( as_ ): relative atom numbers of a selection |
- returns iarray of relative atom numbers in a single object.
This iarray can be saved and later reapplied with the Select ( os_ I )
function. If you selection covers more than one object, the function returns an error.
Example:
build string "se ala"
ii = Iarray( a_//c* ) # returns {6,8,12}
Select( a_ ii ) # returns three carbons
Iarray( [as_|rs_] number ): residue numbers of a selection |
- returns iarray of residue numbers for an input selection.
Example:
build string "ala glu"
Iarray( a_/ number ) # residue level
Iarray( a_// number ) # atom level
Iarray( stack ): numbers of visits for all stack conformations |
Iarray( stack )
- returns the iarray of the numbers of visits for each stack conformation.
This is the same number as shown by the nvis> line of the show stack command.
Example:
show stack
iconf> 1 2 3 4 5
ener> -15.3 -15.1 -14.9 -14.8 -13.3
rmsd> 84.5 75.3 6.4 37.2 120.8
naft> 3 0 4 0 2
nvis> 10 9 8 1 4
Integer(stack) # returns { 10 9 8 1 4 }
creates a "sequence" for an ICM molecular object.
Output is in icm.se -file format.
IcmSequence ( { sequence | string | rs_ }, [ s_N-Term, s_C-Term ] )
- returns multiline string with full (3-char.) residue names which may be a content of an icm.se file.
The source of the sequence may be one of the following:
- a sequence, e.g. IcmSequence(1crn_m)
- a string, e.g. "ASDGFRE", or "SfGDA;WER" .
- or residue selection, rs_ , (e.g. a_2,3/* ).
Rules for one-letter coding:
- standard L amino-acids: upper case one-letter code (B,J,X,Z are illegal), e.g. ACD
- D-amino acids: lower case for a corresponding amino acid (e.g. AaA for ala Dala ala )
- new molecule: use semicolon or dot as a chain separator ( ; ) ( e.g. AAA;WWW )
If the source of the icm-sequence is a 3D object, the proline ring puckering is analyzed and
residue name prou is returned for the up-prolines (the default is pro ).
The N-terminal and C-terminal groups will be added if
their names are explicitly specified or an oxt atom is present in the last residue
of a chain. Here are the possibilities for automated recognition of C-terminal residue:
IcmSequence( a_/* ) # C-terminal residue "cooh" will be added if oxt is found
IcmSequence( a_/* "","" ) # no terminal groups will be added
IcmSequence( a_/* "","@coo-" ) # "coo-" will be added only if oxt is found
IcmSequence( a_/* "nh3+","coo-" ) # "nh3+" and "coo-" will always be added
The resulting string can be saved to a ICM mol-sequence file and further edited
for unusual amino-acids (see icm.res ).
Examples:
write IcmSequence(seq1) "seq1.se" # create a sequence
# file for build command
show IcmSequence("FAaSVMRES","nh3+","coo-") # one peptide with Dala
show IcmSequence("FAAS.VMRES","nter","cooh") # two peptides
show IcmSequence("AA;MRES","nter","cooh") # two peptides
read pdb "2ins"
write IcmSequence(a_b,c/* ,"nter","@cooh") "b.se" # .se file for b
# and c chains
In the last command the ampersend means that the C-terminal residue will only be
added if an oxt atom is present in the last residue.
There is a build string command to create a single or multiple chain
peptides. Example:
build string "SDSRAARESW;KPLKPHYATV" # two 10-res. peptides
See also icm.se for a detailed description of the ICM-sequence file format.
Image( slides )
- returns the image array containing slide thumbnails. E.g.
group table t Image( slideshow.slides )
Image( grob texture )
- returns the image array with textures stored in the grob
see also set texture
Image( images i_newWidth i_newHeight [s_method] )
returns array with resized images. By default uses high quality but slow algorithm.
Other algorithms are available by specifying the scaling method:
| method | description
|
|---|
| "fast" | the fastest method, has the lowest quality of scaling
| | "bilinear" | usually about 1.5-2x times slower than "fast" but produces images of higher quality
| | "glu" | driver-dependent, requires the graphics to be enabled, may have limitations on evenness of requested dimensions.
The quality is usually high, the speed depends on driver implementation.
|
Image( i_width i_height [s_color ("black")] )
returns an image with the specified sizes and of the specified color.
May be useful for blending images with a certain color (the default value is 'black').
Example:
I = Sum( Image(100,60,"red"), Image(100,60,"#00FF00") )
See also: image parray, Sum image, Color image
[ Index chemical | Index string | Index regexp | Index table selection | Index table label | Index unique elements | Index element in array | Index tree ]
family of functions. It returns either an integer or an integer array of indices in an array
or a table.
Index of compounds in chemarray with matching chemical patterns. |
Index( chem_array , chemical_or_chemarray , [ sstructure [group] ] [ stereo ] [ salt ] )
- returns iarray of indices of compounds from the first chem_array
that contain any of identical compounds (the default), or substructure patterns (the sstructure option) from the chemical array.
Example in which we find the nitro compounds among the known drugs:
read table "oralDrugs.sdf" name = "drugs"
modify oralDrugs.mol delete salt
nitrocomps= t[Index(t.mol Chemical("N(=O)O") sstructure )]
Options
- The group option toggles a special search mode when all atoms in the pattern except the attachment
points require the exact chemical match.
- With stereo option chirality will be taken into account.
- With salt option all molcule fragments will be matched. (useful for exact mode)
Example:
add column t Chemical( {"CCC","CCO", "CC", "CCC", "CCC.C", "CC", "CCC"} )
Index( t.mol t.mol[1] ) # find all occurrences of the first molecule ( disregarding stereo and salt )
Index( t.mol t.mol[1] salt ) # find all occurrences of the first molecule (salt is taken into account )
Index( chem_array , chemical_or_chemarray r_distThreshold )
returns iarray of indices of compounds from the first chem_array with chemical distanceless than r_distThreshold to at least one compound from chemical_or_chemarray.
Finding indices of duplicate entries Index( chem_array exact [ salt ] [ stereo ] )
returns iarray of indices of duplicates (entries found more than once).
This function can be useful to remove redundant compounds from the set.
Options:
- Index( X exact ) : selects duplicates by only the main molecule, considers different salts and stereoisomers identical
- Index( X exact salt ) : selects duplicates by considering all molecules, so different salts appear as non-duplicate
- Index( X exact stereo ) : selects duplicates, different stereo isomers are taken into account
- Index( X exact salt stereo ) : selects duplicates by considering stereo isomers and considering all molecules
Example:
add column t Chemical( {"CCC","CCO", "CC", "CCC", "CCC.C", "CC", "CCC"} )
show Index( t.mol exact ) # returns {4,5,7,6}
delete t[ Index( t.mol exact salt ) ] # remove duplicates. preserves different salts
See also: Nof Find find table find molcart
Index ( { s_source | seq_source }, { s_pattern | seq_pattern }, [ { last | i_skipToPos ] )
- returns integer value indicating the position of the pattern substring in the source string,
or 0 otherwise.
Option last returns the index of the last occurrence
of the substring.
The i_skipToPos argument starts search from the
specified position in the source string,
e.g. Index("words words","word",3) returns 7 .
If i_skipToPos is negative, it specifies the number of characters
from the end of the string in which the search is performed.
Examples:
show Index("asdf","sd") # returns 2
show Index("asdf" "wer") # return 0
a=Sequence("AGCTTAGACCGCGGAATAAGCCTA")
show Index(a "AATAAA") # polyadenylation signal
show Index(a "CT" last) # returns 22
show Index(a "CT" 10) # starts from position 10. returns 22
show Index(a "CT", -10) # search only the last 10 positions
Another example in which we output all positions of all
-"xxx.." stretches in a sequence " xxxx xxxxx xxxx ... xxxx "
(must end with space)
EX = "xxxx xxxxxx xxxxxxxxxxxxxx xxxxxx xxx "
sp=0
while(yes)
x=Index(EX "x" sp)
if(x==0) break
sp=Index(EX " " x)
print x sp-1
endwhile
Index of an expression or an array of expressions |
Index ( s_source|S_N_source, { s_pattern| S_N_patterns }, exact | simple | regexp )
Options:
- exact : search for an exact substring or a matching array of substrings in a source string or array
(e.g. Index({"John","Jon"},"J"),exact)}
- simple : case-insensitive search for an substring or a matching array of substrings in an array
(e.g. Index({"John","Jon"},"j"),simple)}
- regexp : search for a regular expression(s) in a string or array
(e.g. Index({"John","Jon"},"[jJ]+",regexp))}
Index numbers of selected table rows |
Index ( T_tableExpression_orSelection ) ⇒ I_matchingRows
Index ( T_table_with_graphical_selection_or_rows selection ) ⇒ I_matchingRows
- returns an integer array of order numbers (indices) of rows selected by
the table expression.
Example in which we find which value of column B corresponds to a value in column A:
group table t {33 22 11} "A" {"a","b","c"} "B"
Index(t.A==22) # returns 2 for 2nd row
#>I
2
t.B[ Index(t.A== 22 )[1] ] # returns B according to A value
b
Index numbers of labeled table rows |
Index ( T_table i_label label ) ⇒ I_matchingRows
- returns an integer array of order numbers (indices) of rows with labels equal to
See also: set label table Label
Indexes of unique elements in an array |
Index ( S_data unique ) ⇒ I_indexes
Index ( I_data unique ) ⇒ I_indexes
- returns iarray containing indexes of unique elements in the data array,
sorted in ascending order.
Examples:
test Index( {1 7 5 7 2 1 1 5} unique )=={1 2 3 5}
test Index( {"a" "A" "a" "B" "A"} unique )=={1 2 4}
Index numbers of selected table rows |
Index ( S_data, s_value ) ⇒ i_FirstMatchingElement
Index ( I_data, i_value ) ⇒ i_FirstMatchingElement
#: Index ( , ) => i_FirstMatchingElement
- returns integer value indicating the first array element number exactly matching the value string or real, or 0 otherwise. To return an array of matches in an array, use the all option (see below).
Examples:
show Index({"Red Dog","Amstal","Jever"}, "Jever") # returns 3
show Index({"Red Dog","Amstal","Jever"}, "Bitburger") # returns 0
show Index({3 ,2, 8},2 ) # returns 2
Index ( S_data, s_value all ) ⇒ I_matchPositions
Index ( I_data, i_value all ) ⇒ I_matchPositions
- returns iarray listing all positions where the value was encountered.
Index ( I_indexes, i_nofElements inverse ) ⇒ I_complementarySetOfIndexes
- this function returns a complement of the input set of indexes. It is similar to a negation of a selection.
Examples:
show Index({"A","B","C","B","B"}, "B") # returns {2,4,5}
show Index({1,2,6,4},3) # returns empty iarray
show Index({1,3} 5 inverse) # returns {2,4,5}
Index ( alignment, sequence )
returns integer index of an identical sequence in the alignment of 0.
Index ( object )
- returns integer value of sequential number of the
current object in the molecular object list, or 0 if no
objects loaded. (Note that here object is used as a keyword.)
Examples:
l_commands = no
read pdb "1crn"
read object s_icmhome+"crn"
printf "The object a_crn. is the %d-nd, while ...\n", Index(object)
set object a_1.
printf "the object a_1crn. is the %d-st.\n", Index(object)
Cluster selection and centers |
Index ( tree center [r_threshold] )
- returns cluster centers (current threshold is taken if not specified)
Index ( tree selection )
- returns indices of table rows which are selected in cluster
function to find location of substring pattern.
Indexx ( { string | sequence }, s_Pattern )
- returns an integer
value indicating the position of the s_Pattern (see
pattern matching)
in the string, or 0 otherwise. Allowed meta-characters are the following:
- * any string including an empty string;
- ? any single character;
- [ string ] any of the enclosed characters;
- [! string ] any but the enclosed characters.
- ^ beginning of a string
- $ string end
Examples:
show Indexx("asdf","s[ed.]") # returns 2
show Indexx("asdfff","ff$") # returns 5 (not 4)
show Indexx("asdf" "w?r") # return 0
function selecting inserted residues.
Insertion ( rs_Fragment, ali_Alignment [, seq_fromAli ][, i_addFlanks ] [{"all"|"nter"|"cter"|"loop"}] )
- returns the residue selection
which form an insertion from the viewpoint of other sequences in the
ali_Alignment. If argument seq_fromAli is given (it must be the
name of a sequence from the alignment), all the other sequences in the alignment
will be ignored and only the pairwise sub-alignment of rs_Fragment and
seq_fromAli will be considered. The alignment must be
linked
to the object. With this function (see also
Deletion( )
function) one can easily and quickly visualize all indels in the three-dimensional
structure. The default i_addFlanks parameter is 0.
String options:
- "all" (or no string option) select insertions of all types
- "nter" select only N-terminal fragments
- "cter" select only C-terminal fragments
- "loop" select only the internal loops
Examples:
read pdb "1phc.a/" # read the first molecule form this pdb-file
read pdb "2hpd.a/" # do the same for the second molecule
make sequences a_*. # you may also read the sequence and
# the alignment from a file
aaa=Align( ) # on-line seq. alignment.
# You may read the edited alignment
# worm representation
assign sstructure a_*. "_"
display ribbon
link a_*. aaa # establish connection between sequences and 3D obj.
superimpose a_1. a_2. aaa
display ribbon a_*.
color a_1. ribbon green
color ribbon Insertion(a_1.1 aaa) magenta
color ribbon Insertion(a_2.1 aaa) red
show aaa
function.
Info ( [ string ] )
- returns the string with the content previous ICM Info message.
Info ( display )
- returns the string with commands needed to restore the graphics view and the background color.
See also: View () , write object auto or write object display=yes .
Info ( term [map|mmff] )
- returns the string with energy terms. E.g.
s_oldterms = Info(term)
..
set terms only s_oldterms
If option map is specified, ICM starts looking for m_gc, m_ge, .. etc. maps
and adds a corresponding term. E.g.
s_termsAccordingToExistingMaps = Info(term map)
If option mmff is specified, ICM will select the correct set of the mmff terms.
Info ( images )
returns sarray with advanced details of images, such as their file format (JPEG, PNG, etc.), dimensions,
color space (e. g. RGB, grayscale), transparency, etc.
function converting to integer type.
Integer ( l_value )
- returns 0 or 1.
Integer ( r_toBeRounded )
- returns the integer nearest to real r_toBeRounded in the direction
of the prevailing rounding mode magnitude of the real argument.
Integer ( string )
- converts string into integer, ignores irrelevant tail. see also Tointeger
Reports error if conversion is impossible.
Examples:
show Integer(2.2), Integer(-3.1) # 2 and -3
jj=Integer("256aaa") # jj will be equal to 256
See also: Iarray( ), Tointeger( )
function.
Integral ( I | R )
returns iarray (or rarray) of the same dimension containing partial sums (from 1 to i )
of the element in the source array. E.g. Integral({2.,2.,2.}) will return 2.,4.,6.
Integral ( R r_xIncrement )
- calculates the integral rarray of the function represented by rarray Ron the periodically incremented abscissa x with the step of r_xIncrement.
Note the difference between this and the above function of partial sums.
The explicit increment form of the function will do the following
- create (n-1) intervals (not n) ,
- will always start from the 0. element
- each next element will be incremented by the area under linearly interpolated broken line.
E.g. Integral({2.,4.,2.},1.) will return 0.,3.,6.,
while Integral({2.,4.,2.}) will return partial sums 2.,6.,8.
Integral ( R_Y R_X )
- calculates the integral rarray of the function represented by R_Y on the set of abscissa
values R_X.
Examples:
# Let us integrate sqrt(x)
x=Rarray( 1000 0. 10. )
plot x Integral( Sqrt(x) 10./1000. ) grid {0.,10.,1.,5.,0.,25.,1.,5.} display
# Let us integrate x*sin(x). Note that Sin expects the argument in degrees
x=Rarray( 1000 0. 4.*Pi )
# 1000 points in the [0.,4*Pi] interval
plot x Integral( x*Sin(x*180./Pi) x[2]-x[1] ) \
{0., 15., 1., 5., -15., 10., 1., 5. } grid display
# x[2]-x[1] is just the increment
Let us integrate 3*x2-1,
determined on the rarray of unevenly spaced x.
The expected integral function is x3-x
x=Rarray(100 ,-.9999, .9999 )
x=x*x*x
plot display x Integral((3*x*x-1.) x) cross
function.
Interrupt
- returns logical yes if ICM-interrupt (Ctrl-Backslash, ^\) has been received by
the program. Useful in scripts and macros.
Examples:
if (Error | Interrupt) return
function returning a molecular/grob label string.
Label ( g_ ) ⇒ s
- returns the string label of the grob. See also: set grob s_label .
Label ( rs_ )
- returns sarray of residue labels of the selected residues
rs_ composed according to the resLabelStyle preference , e.g.
{ "Ala 13","Gly 14"}
See also: Name function (returns residue names), and Sarray( rs [append|name|residue]) function
returning selection strings.
Label ( os_objects )
- returns sarray of long names of selected objects.
See also: Name
function which returns the regular object names and the most detailed
chemical names of compounds.
Label ( vs_var )
- returns sarray of labels of selected variables.
Examples:
build string "ala his glu lys arg asp"
resLabelStyle = "Ala 5" # other styles also available
aa = Label(a_/2:5) # extract residue name and/or residue number info
show aa # show the created string array
Label ( T_table )
- returns iarray of table row labels (marks) set from the GUI or by set label command
Examples:
group table t {1 2 3} "A"
set label t 1 index={1,3}
Label(t)
Label ( chem_ chiral )
- returns sarray of chiral labels for the set of compounds.
Each element of the array may have one of the following values:
- "" (empty - chiral compound)
- "chiral" (chiral compound)
- "racemic" (compound with one or more undefined chiral centers)
See also: set label table Index table label
function.
Length ( { string | matrix | sequence | alignment | profile } )
- returns integer length of specified objects.
Length ( sarray )
- returns iarray with lengths of strings elements of the sarray.
Length ( seqarray )
- returns iarray with lengths of sequence parray elements.
Length ( {iarray | rarray } )
- returns the real vector length (distance from the origin
for a specified vector
Sqrt(Sum(I[i]*I[i])) or Sqrt(Sum(R[i]*R[i])), respectively).
Examples:
len=Length("asdfg") # len is equal to 5
a=Matrix(2,4) # two rows, four columns
nCol=Length(a) # nCol is 4
read profile "prof" # read sequence profile
show Length(prof) # number of residue positions in the profile
vlen=Length({1 1 1}) # returns 1.732051
See also: Nof
the linear regression function.
LinearFit( R_X , R_Y , [ R_Errors] )
- returns a 4-element rarray A,B,StdDev,Corr
of the parameters of the linear regression for a scatter plot Y(X):
R_Y = A*R_X + B , where the slope A and the intercept B are the first
and the second elements, respectively. The third element is the
standard deviation of the regression, and the fourth is the correlation coefficient.
Residuals R_Y - ( A*R_X + B) are stored in the R_out array.
You can also provide an array of expected errors of R_Y .
In this case the weighted sum of squared differences will be
optimized. The weights will be calculated as:
Wi = 1/R_Errorsi 2
Example:
X = Random(1., 10., 10)
Y = 2.*X + 3. + Random(-0.1, 0.1, 10)
lfit = LinearFit(X Y)
printf "Y = %.2f*X + %.2f\n", lfit[1],lfit[2]
printf "s.d. = %.2f; r = %.3f\n", lfit[3],lfit[4]
show column X, Y, X*lfit[1]+lfit[2], R_out
A more complex linear fit between a target set of Yi , i=1:n values
and several parameters Xi,j (i=1:n,j=1:m)
potentially correlating with Yi is achieved in 3 steps:
M1=Transpose(X)*X
M2=Power(M1,-1)
W =(M2*Transpose(X))*Y
The result of this operation is vector of weights W for each of m
components.
Now you can subtract the predicted variation from the initial
vector ( Y2 = Y - X*W ) and redo the calculation to find W2 , etc.
A proper way of doing it, however, is to calculate the eigenvalues
of the covariance matrix.
LinearModel( T_weights )
creates a linear regression prediction-model like:
Y = 5*A + 10*B + 20The resulting model can then be applied to any table with columns required by the model.
The T_weights table should have two columns:
sarray called "name" with column names,
and rarray "w" with weights.
It may also have a real header "b" specifying the free term
(the default value is 0.).
For example, tables produced by the
model weight function for other regression models may be used as input for LinearModel.
So it is possible to obtain weights from a PLS model,
refine or simplify them, and create a new linear regression model:
n = 1000
add column T Random(-10., 10., n) name="A"
add column T Random(-10., 10., n) name="B"
add column T Random(-10., 10., n) name="C"
add column T T.A + 10.*T.B - 5.*T.C name="Y"
learn T.Y type="plsRegression" name="Y"
Y1 = LinearModel( Table( Y term ) )
predict T Y1
A simple model example: Y = 0.7*A + 2.3*B - 10.*C + 5.6
# Build model
add column WT {"A", "B", "C"} name="name"
add column WT {0.7, 2.3, -10.} name="w"
add header WT 5.6 name="b"
Y = LinearModel( WT )
# Predict
n = 100
add column T Random(-10., 10., n) name="A"
add column T Random(-10., 10., n) name="B"
add column T Random(-10., 10., n) name="C"
predict T Y
See also: Table model , predict, learn
the logarithm function.
Log ( real )
- returns the real
natural logarithm of a specified positive argument.
Log ( real r_realBase)
- returns the
real
logarithm of a specified positive argument
(e.g. the base 10 logarithm is Log(x, 10)).
Log ( rarray )
- returns an rarray
of natural logarithms of the array components (they must not be negative,
zeroes are treated as the least positive real number, ca. 10-38).
Log ( rarray r_realBase )
- returns an rarray
of logarithms of the array components (they must not be negative),
arbitrary base.
Log ( matrix [ r_realBase ] )
- returns a
matrix
of logarithms of the matrix components (they must not be negative).
Examples:
print Log(2.) # prints 0.693147
print Log(10000, 10) # decimal logarithm
print Log({1.,3.,9.}, Sqrt(3.)) # {0. 2. 4.}
See also: Power
function.
Map( m_map cell )
- returns map in the limits of the crystallographic cell (a,b,c,alpha,beta,gamma).
The source map needs to be equal in size or greater to the asymmetric unit of the cell.
This function helps to prepare local maps for real space refinement
(see make map potential m R_6box )
Map( m_map , I_6box [ simple ] )
- returns map which is a transformation (expansion or reduction) of the input m_map
to new I_6box box ({ iMinX,jMinY,kMinZ,iMaxX,jMaxY,kMaxZ}).
Note that the order of axes in most crystallographic is defined by the MAPS,MAPR,MAPS
parameters and is not always x,y,z. The correctly ordered index is returned by the
Index(
Map( m_map , as )
returns a map around selected atoms . The index box of this selection is returned by the
Index( ) function
Examples:
read object "crn"
read map "crn"
display a_//ca,c,n m_crn
m1 = Map(m_crn, {0 0 0 22 38 38}) # half of the m_crn
m2 = Map(m_crn, {0 0 0 88 38 38}) # double of the m_crn
display m1
display m2
See also : make grob map to generate contour around a particular selection
function.
Mass( as_ | rs_ | ms_ | os_ )
- returns rarray of masses of selected atoms, residues, molecules or objects,
depending on the selection level.
Examples:
build string "ala his trp glu"
objmasses = Mass( a_*. )
molmasses = Mass( a_* )
resmasses = Mass( a_/* )
masses=Mass( a_//!?vt* ) # array of masses of nonvirtual atoms
molweight = Mass( a_1 )[1] # mol.weight of the 1st molecule
molweight = Sum(Mass( a_1//* )) # another way to calculate 1st mol. weight
See also: Nof( sel atom ), Charge( sel ) , Moment ( sel | X_ ) (principal moments of inertia)
Moment( as_nObj|X_n [ pca | simple | all ] )
returns an array of principal moments of inertia for the selected atoms
in each selected object. The input array can also be a parray of chemicals (see Chemical ).
Options:
- pca (or no option) : the function returns an array with 3*nObject elements with 3 principal moments of inertia for the selection in each object
- simple : the function returns an array with nObject elements with the largest principal moments of inertia (out of three) for the selection in each object
- all : the function returns an array with nObject elements with the product of square roots of the principal moments of inertia for the selection in each object. For linear molecules Ixx==Iyy and Izz=0.. In that case the function returns Ixx rather than sqrt(Ixx*Iyy*Izz)
Note: for a linear molecule, the third component of the moment of inertia will be zero.
Example:
build string "ASD"
build string "G"
Moment(a_*.//* ) # three components for each object
3470.9 # first object
2886.5
855.1
167.5 # second object
124.9
48.4
Moment(a_*.//* simple ) # two largest moments of inertia
3470.980225
167.546844
Moment(a_1./2:3/ca pca ) # just two atoms: a linear molecule
86.0
86.0
0.0
Match( s_where s_regexp [i_field=0 [i_startPos=1]] ) ⇒ s_match
- returns the matched substring (or empty string).
Example with parsing swiss id, name and description (see macro readUniprot):
id_sw = Match(swissEntryHtmlLine, "<DT><A HREF=\"/uniprot/(.+)\">(.+)</A> \(<b>.+</b>\)<DD>(.+)" 1)
namesw = Match(swissEntryHtmlLine, "<DT><A HREF=\"/uniprot/(.+)\">(.+)</A> \(<b>.+</b>\)<DD>(.+)" 2)
descsw = Match(swissEntryHtmlLine, "<DT><A HREF=\"/uniprot/(.+)\">(.+)</A> \(<b>.+</b>\)<DD>(.+)" 3)
Match( all s_where s_regexp [i_field=0 [i_startPos=1] ) ⇒ S_matches
- returns an sarray with all matched expression
Match( S_where s_regexp [i_field=0 [I_startPos={1,..}]] ) ⇒ S_matches
- returns an sarray with matched substrings, the resulting array has the same size as the input array
[ Matrix new | Matrix sub | Matrix symmetrical | Matrix residue comparison | Matrix table | Matrix tensor | Matrix residue areas | Matrix alignment | Matrix boundary | Matrix stack | Matrix histogram | Matrix grob connectivity ]
function.
Matrix : create new matrix. |
Matrix( i_NofRows, i_NofColumns [ r_value] )
- returns matrix of specified dimensions. All components are set to zero or r_value if specified.
Matrix( i_n [ R_n_diagonal ] )
Matrix( i_n [ R_m_row ] )
- returns square unity matrix of specified size. A matching array of diagonal values can be provided.
If the array size does is not equal to i_n , a matrix with i_n rows with R_m_row values will be returned.
Example:
Matrix(3,{1. 2. 3.})
#>M
1. 0. 0.
0. 2. 0.
0. 0. 3.
Matrix(3,{1. 2.})
#>M
1. 2.
1. 2.
1. 2.
Matrix( nRows [ R_row ] )
multiples R_row vector nRows times into a matrix. Make sure that nRows is not equal to
Nof( R_row ) . Example: Matrix(10, {1. 2. 3.})
Matrix( rarray [ n ] )
- converts vector[1:n] to one-row matrix[1:1,1:n].
If you provide a positive integer argument, the input rarray will be
divided into rows of length n. If the argument is negative, it will be split
into columns of length n. Examples,
Matrix({1. 2. 3. 4. 5. 6.},3)
#>M
1. 2. 3.
4. 5. 6.
Matrix({1. 2. 3. 4. 5. 6.},-3)
#>M
1. 4.
2. 5.
3. 6.
Matrix({1. 2. 3. 4. 5. 6.},4)
Error> non-matching dimension [4] and vector size [6]
Matrix : extract a sub-matrix |
Matrix( M_square i_rowFrom i_rowTo i_colFrom i_colTo ) ⇒ M
a submatrix of specified dimensions. To select only columns or rows,
use zero values, e.g.
Matrix( Matrix(3) 0,0,1, 2) # first two columns
Matrix symmetrization, extraction of left and right triangles. |
Matrix( M_square { left | right } )
- generate a symmetrical matrix by duplicating the left or the right triangle of initial square matrix.
Example:
icm/def> m
#>M m
1. 0. 0.
0. 1. 0.
7. 0. 7.
icm/def> Matrix( m right )
#>M
1. 0. 0.
0. 1. 0.
0. 0. 7.
icm/def> Matrix( m left )
#>M
1. 0. 7.
0. 1. 0.
7. 0. 7.
Matrix of residue substitution values. |
Matrix( comp_matrix s_newResOrder )
- returns comparison matrix in the specified order.
Example in which we extract cysteine, alanine and arginine comparison values:
icm/def> Matrix(comp_matrix "CAR")
#>M
2.552272 0.110968 -0.488261
0.110968 0.532648 -0.133162
-0.488261 -0.133162 1.043102
Converting table columns into matrix |
Matrix ( T [ S_colnames ] ) ⇒ M
Example:
add column t {1 2} {3 4} {4 5} # columsn .A .B .C
M = Matrix( t ) # 3x2 matrix
mm = Matrix( t {"B","C"} ) # 2x2 matrix with .B and .C
The inverse operation is also possible with the Table ( matrix , S_colNames ) function.
Matrix resulting from a tensor product fo two vectors. |
Matrix( R_A R_B )
- returns tensor product of two vectors or arbitrary dimensions:
M_ij = R_A[i]*R_B[j]
Examples:
mm=Matrix(2,4) # create empty matrix with 2 rows and 4 columns
mm=Matrix(2,4,-5.) # as above but all elements are set to -5.
show Matrix(3) # a unit matrix [1:3,1:3] with diagonal
# elements equal to 1.
a=Matrix({1. 3. 5. 6.}) # create one row matrix [1:1,1:4 ]
Matrix({1.,0.},{0.,1.}) # tensor product
#>M
0. 1.
0. 0.
Matrix of residue-residue contacts |
Matrix ( rs_1 rs_2 )
- returns matrix of contact areas.
See also: Cad, Area .
Matrix of inter-sequence distances |
Matrix ( ali_ )
- returns a matrix of normalized pairwise Dayhoff evolutionary distances
between the sequences in alignment ali_
(for similar sequences it is equal to the fraction mismatches).
Matrix ( ali_, number )
- returns a matrix of alignment. It contains reference residue
numbers for each sequence in the alignment, or -1 for the gaps.
The first residue has the reference number of 0
(make sure to add 1 to access it from the shell).
Matrix from the electrostatic boundary element calculation |
Matrix ( boundary )
- returns values generated by the make boundary command for each atom.
Matrix of distances between the stack conformations |
Matrix ( stack )
- returns distance matrix of stack conformations according to the
compare command and the vicinity parameter. Used for clustering of the stack
conformations.
Matrix containing a histogram |
Matrix( R_Xn R_Yn R_ruler )
- retuns 2D histogram of X and Y values.
The R_ruler array consists of limits for X and Y
and step sizes for X and Y and optional bin sizes: {xFrom, xTo, yFrom, yTo, [xStep, yStep] } .
Returned values:
- R_out : contains ruler and actual bin sizes:
Example:
icm/def> Matrix(Random(0. 5. 20) Random(0. 5. 20) {0. 5. 0. 5. 1. 1.})
#>M
1. 0. 2. 1. 0.
1. 1. 1. 1. 2.
0. 2. 1. 1. 0.
0. 1. 0. 0. 1.
1. 0. 0. 1. 2.
Connectivity Matrix for Grob Vertices |
Matrix( grob wire ) ⇒ M_one_or_large_number
Returns a matrix n_vertices by n_vertices containing 1. for connected vertices and a large number for unconnected.
Example:
g = Grob("cell",{1. 2. 3.}) # a box with 8 vertices
g = Matrix(g wire)
16777216. 1. 1. 16777216. 1. 16777216. 16777216. 16777216.
1. 16777216. 16777216. 1. 16777216. 1. 16777216. 16777216.
1. 16777216. 16777216. 1. 16777216. 16777216. 1. 16777216.
16777216. 1. 1. 16777216. 16777216. 16777216. 16777216. 1.
1. 16777216. 16777216. 16777216. 16777216. 1. 1. 16777216.
16777216. 1. 16777216. 16777216. 1. 16777216. 16777216. 1.
16777216. 16777216. 1. 16777216. 1. 16777216. 16777216. 1.
16777216. 16777216. 16777216. 1. 16777216. 1. 1. 16777216.
[ Max image graphic ]
maximum-value function.
Max ( { rarray | map } )
- returns the real maximum-value element of a specified object
Max ( iarray )
- returns the integer maximum-value element of the iarray.
Max ( R1_n R2_n ) ⇒ R_max_n
- returns the rarray of maximal values.
Max ( index { iarray | rarray } )
- returns the integer index of the maximum-value element of the array (or one of them if many).
Max ( clsuterObject )
- returns distance of the root node
cl = Split( t.cluster, Max( t.cluster )/2 )
Max ( index { iarray | rarray } group I_clusterNumbers )
- returns the iarray of indices of maximal values, e.g.
Max(index { 1. 3. 1. 2. 5.} group { 1 2 1 2 2} )
#>I
1
4 # the maximal element 2. has index 4
see also Min(.. ) and the group .. command.
Max ( matrix )
- returns the rarray of maximum-value element of each column of the matrix.
To find the maximum value use the function twice ( Max(Max( m)) )
Max ( matrix_nm matrix_nm ) ⇒ M_max_nm
- returns the matrix with the larger values of the two input matrices of the same dimensions.
Max ( integer1, integer2, ... )
- returns the largest integer argument.
Max ( real1, real2, ... )
- returns the largest real argument.
Max ( S s_leadingString )
returns the maximal trailing number in array elements consisting of the s_leadingString and a number.
If there are no numbers, returns 0.
E.g. Max({"a1","a3","a5"},"a") returns 5.
Max( *grob | *macro | *sequence | *alignment | *profile | *table | *map )
returns the maximal number of shell objects of the specified class. To increase this
shell limit, modify the icm.cfg file.
Max ( grob s_leadingString )
returns the maximal number appended to grob names:
g_skin_1
g_skin_2
This function is equivalent to Max( Name(grob), s_leadingString ) (see the previous function).
Examples:
show Max({2. 4. 7. 4.}) # 7. will be shown
Recommended setting for GRAPHICS.quality in images |
Max( image graphic )
- returns the recommended value of GRAPHICS.quality to be used with commands which generate images.
Example:
write image memory GRAPHICS.quality=Max(image graphic)
an array of three maximal crystallographic h,k,l indices at a given resolution.
MaxHKL( { map_ | os_ | [ R_6CellParameters ] }, r_minResolution ) ⇒ I3
the function extracts the cell parameters from map_ , os_ object, or
reall array of {a,b,c,alpha,beta,gamma}, and calculates an iarray of three maximal
crystallographic indices { hMax , kMax , lMax } corresponding to the specified
r_minResolution .
average-value function.
Mean ( { rarray | map } )
- returns the real average-value of elements of the specified ICM-shell objects.
Mean ( iarray )
- returns the real average-value of the elements of the iarray.
Mean ( matrix )
- returns rarray [1:m] of average values for each i-th column matrix[1:n,i].
Mean ( R1 R2 )
- for two real arrays of the same size returns rarray [1:m] of average values for each
pair of corresponding elements.
Examples:
print Mean({1,2,3}) # returns 2.
show Mean(Xyz(a_2/2:8)) # shows {x y z} vector of geometric
# center of the selected atoms
Mean({1. 2. 3.} {2. 3. 4.})
#>R
1.5
2.5
3.5
minimum-value function.
Min ( { rarray | map } )
- returns the real minimum value element of a specified object
Min ( index { iarray | rarray } )
- returns the integer index of the minimum-value element of the array (or one of them if many).
Min ( index { iarray | rarray } group I_clusterNumbers )
- returns the iarray of indices of minimal values, e.g.
Min( index { 1. 3. 1. 2. 5.} group { 1 2 1 2 2} )
#>I
1
4 # the minimal element 2. has index 4
see also Max(.. ) and the group .. command.
Min ( iarray )
- returns the integer minimum-value element of the iarray.
Min ( R1_n R2_n ) ⇒ R_min_n
- returns the rarray of minimum values.
Min ( matrix )
- returns the rarray of minimum-value element of each column of the matrix.
To find the minimum value use the function twice (e.g. Min(Min(m)) )
Min ( matrix_nm matrix_nm ) ⇒ M_min_nm
- returns the matrix with the smaller values of the two input matrices of the same dimensions.
Min ( integer1, integer2 ... )
- returns the smallest integer argument.
Min ( real1, real2, ... )
- returns the smallest real argument.
Examples:
show Min({2. 4. 7. 4.}) # 2. will be shown
show Min(2., 4., 7., 4.) # 2. will be shown
Min ( alignment, sequence ) ⇒ i_nearestSeq
- returns the integer index of the nearest sequence in the alignment.
To get the name of the nearest sequence, use the Name function. Example:
read alignment s_icmhome+"sh3"
b = Sequence("KKYAKAKYDFVARNSSELSMKDDVLELILDD") # like Eps8 seq
iseq = Min(sh3, b) # returns 3.
nam = Name(sh3)[iseq] # "Eps8" is the closest sequence
show $nam
function to print money figures.
Money ( { i_amount | r_amount}, [ s_format] )
- returns
a string with the traditionally decorated money figure.
s_format contains the figure format and the accompanying symbols.
- %m specification for the rounded integral
amount;
- %.m specification to add cents after dot. The default is "$%.m", i.e.
Money(1222.33) returns $1,222.33.
- %M the same as %m but with dot instead of comma in the European style
- %.M the same as %.m dot and comma are inverted in the European style
Examples:
Money(1452.39) # returns "$1,452.39"
Money(1452.39,"DM %m") # returns "DM 1,452"
Money(1452.39,"%.M FF") # inverts comma and dot "1.452,39 FF"
remainder (module) function. Similar to, but different from Remainder() function:
| function | description | example
|
|---|
| Mod(x,y) | brings x to [0 , y] range | Mod(17.,10.) => 7.
| | Remainder(x,y) | brings x to [-y/2 , y/2] range | Remainder(17.,10.)=> -3.
|
Mod ( i_divisor, [ i_divider ] )
- returns integer remainder.
Mod ( r_divisor, [ r_divider ] )
- returns the
real
remainder r = x - n*y where n is the integer nearest the exact value of x/y;
r belongs to [ 0, |y| ] range.
Mod ( iarray, [ i_divider ] )
- returns the
iarray
of remainders (see the previous definition).
Mod ( rarray, [ r_divider ] )
- returns the
rarray
of remainders (see the previous definition).
The default divider is 360. (or 360) since we mostly deal with angles.
Examples:
phi = Mod(phi) # transform angle to [0., 360.] range
a = Mod(17,10) # returns 7
molecule function.
Mol ( { os_ | rs_ | as_ } )
- selects
molecules
related to the specified objects
os_
, residues
rs_
or
atoms
as_,
respectively.
Note that there is an obsolete Mol function to return a mol/sdf formatted string .
The up-to-date version of this function is String( X )
Examples:
show Mol( Sphere(a_1//* 4.) )
# molecules within a 4 A vicinity of the first one
# Sphere function Sphere(as_atoms) selects atoms.
See also: Atom, Res, Obj .
[ Name chemical property | Name soap | Name close sequence | Name string | Name tree | Name chemical | Name sequence | Name object parray | Name image | Name molcart ]
generic function returning strings or string arrays with names of things.
Name ( )
- returns empty string.
Name ( s_Path_and_Name )
- returns file name sub- string if full path is specified
Name( s_hint [ simple | unique | object ] )
Opions:
- simple : removes non-alpha-numeric symbols from a string and replaces them by underscore.
- object : finds a name for a new object starting from s_hint and ensures its uniqueness
- unique : checks if the name s_ exists in the ICM-shell. If the name does not exist, it is returned
without changes, otherwise a number is appended to the name to guarantee its uniqueness.
Examples:
Name( " %^23 a 2,3 xreno-77-butadien" simple)
23_a_2_3_xreno_77_butadien
a=1
Name("a",unique)
a1
Unique molecular object names and unique molecule names in a given object Name( s_hint object unique )
Name( s_hint os_object unique )
Name of the shell variable
Name( variable any_shell_variable )
- returns a string with a name of a provided shell variable.
Example:
add column t {1 2 3} name="A"
Name( variable t )
Name( variable t.A )
All names of objects in a given class Name ( className ) ⇒ S_names
- returns a string array of object names for the specified class.
Classes:
command,function,macro,integer,real,string,logical,iarray,rarray,sarray,matrix,map,grob,alignment,table,profile,sequence
Subclass of strings: html-objects and scripts Name( string [ html | command ] )
returns the list of html documents or scripts in ICM shell
Name ( { iarray | rarray | sarray | matrix | map | grob | alignment | table | profile | sequence | chemical | reaction | slide | model | tree } selection )
- returns a string array of names of selected objects for the specified class.
Name ( as_ )
- returns sarray of names of selected atoms.
Name ( as_ sequence )
- returns sarray of chemical names of the selected atoms according to the icm.cod
file (one-letter chemical atom names are low case, e.g. "c", two-letter
names start from an upper-case letter, like "Ca"). The names from the
periodic table are used in the wrGaussian macro.
Name ( rs_ )
- returns sarray of names of selected residues.
To obtain a one-letter code sequence, use Sequence( rs_ )
and to convert it to a string use String( Sequence( rs_ )) .
Name ( ms_ )
- returns sarray of names of selected molecules.
Name ( chem_array )
- returns sarray of names of chemicals in an array ( see also )
Name ( ms_ sequence )
- returns sarray of names of sequence linked to the specified molecules ms_ or empty strings.
Name ( ms_ alignment )
- returns sarray of names of alignments linked to the specified molecules ms_ or empty strings
Name ( ms_ swiss )
- returns sarray of names of swissprot names corresponding to the specified molecules ms_ or empty strings . See also the set swiss command.
Name( os_ )
- returns sarray of names of selected objects. E.g. Name( a_ )[1] returns string with the name of the current object.
Name ( vs_ )
- returns sarray of names of selected variables.
Name ( alignment )
- returns sarray of constituent sequence names.
Name ( table )
- returns sarray or constituent table ICM-shell object names.
Name ( sequence )
- returns string name of specified sequence.
Name( T column )
- returns sarray of column names
Name( T header )
- returns sarray of header names
Name( T selection )
- returns sarray of selected (in GUI) column names
Name( gui {html|table|alignment} )
- returns sarray of shell objects in the order of their tabs appear in the GUI. Notice that the order of
tabs corresponding to html-documents, tables or alignments can be changed with drag and drop.
It will lead to a different order retuned by the Name function.
Name( foreground {html|table|alignment|slide} )
-returns name of the currently active object in the class.
Examples:
read alignment msf s_icmhome+"azurins" # load alignment
seqnames = Name(azurins) # extract sequence names
show Name( Acc( a_/* ) ) # array of names of exposed residues
Name( chemical property ) function |
Name( chemical property )
- returns sarray of names of loaded predictive models (e.g. "MolLogP") for chemicals.
List name of the fields in SOAP struct object |
Name( soapStruct )
See SOAP services for further information.
Find the name of the closest sequence in an alignment |
Name( ali seq_ ) ⇒ s_nameOfTheClosestSequence
Example:
read alignment s_icmhome+"sh3" # alignment
readUniprotWeb "FYN_HUMAN"
Name(sh3,FYN_HUMAN) # returns "Fyn"
Name( string .. ) function |
Name( string html )
- returns sarray with the names of all the HTML objects in the project
Name( string command )
- returns sarray with the names of all the scripts in the project
Name( tree-parray i_parrayIndex [index|label|matrix|sort|split] )
- returns string names of different properties of the tree cluster object.
The following names can be returned:
Name( chemarray )
- returns sarray of names of chemarray.
Note that function does not generate a systematic (IUPAC) name. It uses names from the first line
of SD/MOL file. Chemical names can also be set with set name command.
See also: set name other chemical functions
Name( seqarray )
- returns sarray with stored names of sequence parray elements
See also: set name sequence
Names of objects in array |
Name( objectArray_ )
- returns sarray with names of objects in the objectArray_
See also: object parray
Name( imageArray_ )
- returns sarray with names of images
See also: image parray
Information from databases |
Name( sql )
- returns current database connectionID string, which can be used as the connect= option with almost all Molcart commands
to specify the connection. See also molcart connection options
Name( sql database )
- returns sarray listing all databases in the current Molcart connection
Name( sql table [s_database] )
- returns sarray listing all tables in the current or specified database
Name( molcart table [s_database] )
- returns sarray listing chemical tables in the current or specified database
Name( sql connect )
- returns sarray with the connection parameters stored in user's settings: {host,user,password,database}
Name( s_dbtable sql column )
- returns sarray listing column names in the specified table. Table name may be prefix with database name with dot.
See also: molcart, Type molcart, Nof molcart
[ Namex sequence | Namex image ]
comment (or description) function.
Namex ( os_ )
Namex ( s_MultiObjectFile )
- returns sarray of comments of selected objects os_
(i.e. a string for each object). This field is set to the
chemical compound name by the
read pdb command. Alternatively, you can
set your own comment with the
set comment os_ s_comment command.
If you have a single object and want to convert
a string array of one element (corresponding to this one object) to a
simple string, use this expression, e.g.: Sum(Namex(a_)).
Other manipulations with a multiline string can be performed with the
Field,
Integer,
Real,
Split functions (see also
s_fieldDelimiter).
Example. We stored values in the comment field in annotations like this: "LogP 4.3\n". Now we extract the values following the "LogP" field name:
remarks = Namex( s_icmhome+"log3.ob") # get remarks directly without reading
group table t Rarray(Field(remarks,"vacuum",1,"\n")) "vacuum"
group table t append Rarray(Field(remarks,"hexadecane",1,"\n")) "hex"
show t
read object s_icmhome + "log3" # read multiple object file
# extract numbers following the 'LogP' word in the object comments
logPs = Rarray(Namex(a_*.),"LogP",1," \n")
Namex ( seq_ )
- returns string of long name ('description' field in Swissprot).
Namex ( seqarray )
- returns sarray with long names of sequence parray elements
Example:
read index s_inxDir+"/SWISS.inx"
read sequence SWISS[2] # read the 2nd sequence from Swissprot
show Namex( sequence[0] )
Namex ( imageArray_ )
- returns sarray with comments associated with images
See also: image parray, Name image .
[ Next covalent neighbors ]
selection function.
Next ( { as_ | rs_ | ms_ | os_ } )
- selects atom, residue, molecule, or object
immediately following the selected one. Next( the_last_element ) returns
an empty selection.
Examples:
read object s_icmhome+"crn.ob"
Next( a_/4 ) # show residues number 5
Covalent neighbors of an atom |
Next ( as_ { bond | tree } )
- selects atoms forming covalent bonds with the selected single atom.
Option tree allows to select only atoms above a given atom in an icm-tree.
Example of a test if a hetatm molecule is covalently attached to a polymer:
- Expand by covalent bonds by one bond
- Count the number of molecules excluding the source molecule (ms1) itself
- if it propagated to other molecules Nof will return a number larger than 0
read pdb "2vsd"
ms1 = a_a2
l_cov_attached = Nof( Mol(Next( ms1 bond)) & !(ms1) ) > 0
Another example:
build string "his"
display
display a_/his/he2 ball red
display Next( a_/his/he2 bond ) ball magenta # show atom preceding he2
cd2_neigh = Next( a_//cd2 bond )
for i=1,Nof(cd2_neigh)
nei = cd2_neigh[i]
print " Distance between a_//cd2 and ",Sum(Name(nei)), " = ", Distance( a_//cd2 nei)
endfor
[ Nof tree | Nof chemical | Nof distance | Nof library | Nof molcart | Nof latent | Nof soap ]
Number-OF-elements function.
Nof ( className )
- returns integer number of objects in a class (e.g. Nof(sequence) ). Classes:
iarray,rarray,sarray,sequence,aselection,vselection,alignment,matrix,map,grob,string,object
Nof ( { iarray | rarray | sarray | chemarray | parray } )
- returns integer number of elements in an array.
Note that distanceParrays or hbondParrays returned by the make distance of make hbond commands have a two-level
structure in which the actual list of bonds or distances is the nested to the main level of this parray. Therefore to get
the number of distances or hbonds one needs to use the following function.
Nof ( hbondChunkArray|distChunkArray distance )
- returns the total number of nested atom pairs.
Nof ( ali_ )
- returns integer number of sequences in the specified alignment ali_
(see also Length( alignment ) ).
Nof ( matrix )
- returns integer number of rows in a matrix (see also Length( matrix) function which returns number of columns).
Nof ( table )
- returns integer number of number of rows in a table
Nof ( map )
- returns integer number of grid points in a map.
Nof ( grob )
- returns integer number of points in graphics object.
Nof( { os_ | ms_ | rs_ | as_ | vs_ } )
- returns integer number of selected objects, molecules, residues, atoms or variables respectively.
Nof ( { atoms | residues | molecules | objects | conf | stack | tether | vrestraint } )
- returns the total integer number things.
- atoms : same as Nof(a_*.//*) , except that Nof(atoms) will work even if the object does not exist.
- residues : same as Nof(a_*.*/*)
- molecules : same as Nof(a_*.*)
- objects : same as Nof(a_*.)
- conf : number of confomations (`conf) in a stack
- stack : number of atoms in an object which was used to create a stack
- tether : the total number of tethers in the current object, same as a_//T
- vrestraint
Nof ( library )
- returns 1 if the force field parameter library is loaded and 0 otherwise.
Nof ( library )
- returns 1 if the mmff library is loaded and 0 otherwise.
Nof ( plane )
- returns the number of active graphical planes
Nof ( site [ ms_ | seq ] )
- returns integer number of sites in the selected molecule or the current object or sequences.
Nof ( { s_stackFileName | s_objFileName } )
- returns integer number of conformations in the specified
Example:
for i=1,Nof("def.cnf",conf) # stack is NOT loaded
read conf i
endfor
Nof ( os_singleObj stack )
- returns integer number of conformations in the object stack. Note that stack stored in object is not the same as the global shared stack.
E.g.
build string "HWEH"
montecarlo store # creates stack and stores it in object
Nof(a_ stack) # returns the number of conformations in object stack
Nof ( string, substring )
- returns integer number of occurrences of substring in a string.
E.g. Nof("ababab","ba") returns 2
Nof ( string, substring, pattern )
- returns integer number of occurrences of regular pattern in a string.
E.g. Nof("ababab","b?",pattern) returns 2
Example with a strange DNA sequence dn1:
if(Nof(String(dn1),"[!ACGT]" pattern) > 0.5*Length(dn1)) print " Warning> Bad DNA sequence"
Nof ( className selection )
- returns integer number of selected ICM-shell variables.
This selection does not work the following types:
aselection, vselection, string , object .
Examples:
nseq = Nof(sequences) # number of sequences currently loaded
if(Nof(object)==0) return error "No objects loaded"
if ( Nof( sequence selection ) == 2 ) a = Align( selection )
Nof ( {table|alignment|grob} display )
- returns integer number of displayed ICM-shell variables.
Nof( grob display ) # number of meshes displayed in 3D
Nof( table display ) # number of spreadsheets visible in GUI
Nof ( tree [i_index=1] )
- returns integer number of entries in the cluster tree.
Nof ( tree [i_index=1] tree )
- returns integer number of clusters at current split level
Nof ( tree [i_index=1] auto )
- returns an integer guess for a recommended number of clusters
Counting various properties/patterns in chemical arrays. |
Nof( chemarray, "ring" )
- returns an iarray containing the number of rings in each array element.
show Nof(Chemical("C1CC2CC1CCC2") "ring" )
Nof( chemarray, "minRing" )
- returns an iarray of max ring sizes
Nof( chemarray, "maxRing" )
- returns an iarray of min ring sizes
Nof( chemarray, chiral [ 1|2|3 ] )
- returns the number of chiral or racemic centers as follows:
- any chiral or racemic center : the default, e.g. Nof(t.mol chiral)
- R centers: type = 1 ,
- S centers: type = 2
- RS or racemic centers : type =3.
Example: add column t Nof(t.mol chiral 3) "nRacemicCenters"
Nof( chemarray, s_smarts [group] )
- return an iarray of number of matches with the SMART pattern for each element of the chemical array.
Options
- the group option toggles the special search mode when all atoms in the pattern except the attachment
points needs to match the chemical exactly.
Examples:
Nof( Chemical("CP(C)(C)=C"), "P~*" )
Nof( Chemical("OP(O)(O)=C"), "P~O" )
Nof( Chemical( "CC(=O)OC1=CCCC=C1C(O)=O" ), "[*;!D1]!@-[*;!D1]" )
# the group option examples
Nof( Chemical("C(=CC=CC1C(=CC=C(C2)C(=CC=CC3)C=3)C=2)C=1") "C(=C1)C=[C*]C=C1" group )[1] # returns 2
Nof( Chemical("C(=CC=CC1C(=CC=C(C2)C(=CC=CC3)C=3)C=2)C=1") "C1C=[C*]C=C[C*]=1" group )[1] # returns 1
See also: other chemical functions SMILES and SMARTS
Counting number of atom pairs, triples and quadruplets in distance objects |
Nof( distobject distance )
counts number of records in the distance parrays created by the following commands.
The full information can be exported into a table with the Table(.. distance) function.
Example:
read pdb "1crn"
convertObject a_ yes yes no no
make hbond name="hbonds_crn"
show Nof( hbonds_crn ) # counts distances
Counting chemical combinatorial library sizes. |
Nof( scaffold library )
- returns the total library size
Nof( scaffold group )
- returns iarray of substituent R-group array sizes
See also: link group , chemical , Chemical .
Nof( s_dbtable sql [s_connectionID] )
- counts the number of entries (rows) in an SQL table
Nof( s_dbtable molcart unique )
- counts unique chemicals in an SQL table
See also: molcart
Number of latent vectors of the PLS model |
Nof( PLS_model i_num
- returns number of latent vectors of the PLS model
See also: learn predict
Number of elements in the soap object |
Nof( soapObject )
- counts numbers of element in complex SOAP object (array or structure)
See SOAP services for information.
returns different norms of a vector, e.g. its euclidian length, or the size of the range of its values.
Norm ( R_vector s_type )
- returns the specified norm of the vector.
Supported norm types ( s_type ) are (this parameter is case-insensitive):
- "range": (default), a difference between the maximal and the minimal value in the vector Max (v) - Min (v)
- "rmsd": the root-mean-square-deviation of vector values from their mean value, also returned by the Rmsd (v) function.
- "euclidean", a.k.a. "L2": the euclidian distance between the origin and a point defined by the input vector. Also returned by: Sqrt(Sum(Power(v,2))), Length (v)
- "cityblock", a.k.a. "L1": the sum of the absolute values of all vector components, Sum(Abs(v))
- "Linfinity", "Linf": the largest value in the vector, also returned by Max(Abs( v ))
Examples:
Norm ( {3., 4.}, "euclidean" )
Norm ( {1. 3. 3. 6. 3. 4. 5.7 7.}, "RMSD" ) # case insensitive
See also: Normalize
normalize vectors or real arrays according to different transformations.
Normalize ( R_vector s_type )
- returns the normalized rarray (i.e. the input vector) by dividing each vector element by its norm (see the
s_type definitions in the Norm () function. Note that this form of normalization is NOT suitable for
elements of a column in a table.
To standardize data in a table column and remove outliers use Trim
Normalize ( matrix )
- returns the matrix linearly transformed into the [0.,1.] range.
The following would hold true for any valid s_type and vector v with non-zero norm:
Norm( Normalize( v, s_type ) s_type ) == 1.
Examples:
2.*Normalize ( {3., 4.}, "euclidean" ) #make euclidean length 2.
See also: Norm
NotInList ( S_list S_testedItems )
returns sarray of S_testedItems elements which are not in the first list.
Example:
NotInList({"cc","aa","bb"} {"aa","dd","ee"}) # returns {"dd","ee"}
object level function.
Obj ( { ms_ | rs_ | as_ } )
- selects object(s) related to the specified molecules, residues or atoms, respectively.
Examples:
show Obj( a_*./dod ) # show objects containing heavy water
See also: Atom, Res, Mol .
function.
Occupancy ( { as_ | rs_ } )
- returns rarray of occupancy for the specified selection.
If residue selection is given, average residue occupancies are returned.
See also:
set occupancy.
Examples:
read object s_icmhome+"crn.ob"
avO=Min(Occupancy(a_//ca)) # minimal occupancy of Ca-atoms
show Occupancy(a_//!h*) # array of occupancy of heavy atoms
color a_//* Occupancy(a_//*) # color previously displayed atoms
# according to their occupancy
color ribbon a_/A Occupancy(a_/A) # color residues by mean occupancy
function.
Path ( )
- returns the working directory (same as Path(directory).
Path ( s_FullFileName )
- returns header sub- string with the path.
Path ( s_FullFileName full )
- returns the full file name including absolute directory, and the filename with extension
Examples:
sPath=Path("/usr/mitnick/hacker.loot") # returns "/usr/mitnick/"
Path("~/.cshrc" full )
/home/crepe/.cshrc
See also: Name() and Extension() functions which return two
other components of the full file name.
Path ( indexTable ) ⇒ s_sourceFile
returns the string path to the source data file for the indexTable .
The full name is returned by the File function.
Example:
write index "/data/chem/nci.sdf" "./nci.inx"
read index "./nci.inx"
Path(nci) # returns location of the source nci.sdf file
/data/chem/
See also: write index , File( T_indexTable database )
Path ( origin )
- returns a path to the ICM executable. ICM binary can also be found in the Version(full)
string.
Versions before 3.5-2 used Path(unix) syntax.
Path ( directory )
- returns the current working directory.
Path ( last )
- returns the path of the last icm-shell script called by ICM.
Path ( preference )
( obsolete ) returns the path to the directory in which the user preferences file "icm.ini"
is stored. This file is always stored in the s_icmhome , but a user can save his or her
own preferences in the s_userDir/config/icm.ini file.
Example:
read all Path(preference)+"icm.ini" # restore the settings
Path ( s_somePath fix )
- returns a string with simplified separators (useful when you want to compare different paths)
Example:
Path("/home/"+"/"+"theuser//" fix ) # == "/home/theuser/"
function containing an array of chemical compounds.
These compounds can be read from the mol/sdf files into
binary chemical representation stored in ICM chem-tables.
Parray ( s_smiles smiles )
Parray ( s_molFileText mol )
Parray ( object )
- returns an object parray containg all ICM molecular objects loaded
Parray ( object os_ [stack] )
- returns an object parray of ICM molecular objects from the object selection.
If stack keyword is specified, the current stack is stored into the object.
Parray ( sequence rs_ )
- returns a sequence parray of size 1 containing the residues specified.
Parray ( sequence )
- returns a sequence parray containing all sequences loaded into ICM
Parray ( sequence|object i_n )
- returns a sequence parray or object parray containing i_n empty objects
Example:
read table mol "ex_mol.mol" name="t"
s = String(t.mol[1]) # sss contains mol/sdf text
t.mol[1] = Parray(s mol) # sss is parced and converted
function.
Pattern ( { s_consensus | ali_ } [ exact ] )
- returns sequence pattern string which can be searched in a single sequence with the
find pattern command or in a database with the
find database pattern=s_pattern command.
If ICM-consensus string s_consensus is provided as an argument, the string
is translated into a regular pattern expression
(e.g. an expression "R+. ..^D" will be translated to "R[KR]?\{3,6\}[ACGS]D" ).
If alignment ali_ is given as an argument, the pattern is either extracted directly from the alignment,
option exact, or is converted to consensus first, and only after that translated into a pattern.
For example, an alignment position with amino acids A and V will be transformed into pattern [AV]
with option exact
and into pattern [AFILMPVW] without the option. Additionally, the exact option
will retain information about the length of the flanking regions.
Example:
read sequence s_icmhome + "zincFing"
group sequence aaa
align aaa
show Pattern("#~???A% ?P") # symbols from consensus string
show Pattern(aaa)
show Pattern(aaa exact)
Pattern ( s_seqPattern prosite | residue )
- returns string containing the prosite -formatted sequence pattern.
The input string s_seqPattern is an ICM sequence pattern .
Pattern ( rs ) ⇒ s_res_barcode
- returns string "barcode" with selected residues followed by the length of the intervening gaps.
This function can be applied with the 'B' and 'Q' residue selections. E.g.
read pdb "1xbb:
Pattern(Res( Sphere( a_H a_A -1.1)))
A47ME1AE1G46L
a_*.*/BA47ME1AE1G46L
function (or rather a reserved name).
Pi
- returns the real value of Pi ( 3.14...).
Examples:
print Pi/2.
function.
Potential ( as_targets as_charges )
- returns rarray of Nof( as_targets) real values of electrostatic potentials
at as_targets atom centers.
Electrostatic potential is calculated from the specified charges
as_charges and the precalculated boundary
(see also REBEL, make boundary
and How to evaluate the pK shift).
Examples:
read object s_icmhome+"crn"
# prepare electrostatic boundary descriptions
make boundary
# potential from oe*, od* at cz of two args
show Potential(a_/arg/cz a_/glu,asp/o?* )
print 0.5*Charge(a_//*)*Potential(a_//* a_//* )
# the total electrostatic energy which is
# actually calculated directly by show energy "el"
mathematical function.
Power ( r_base, { r_exp | i_exp} )
- returns real r_baser_exp or r_basei_exp.
Note that r_base may be negative if the exponent is an integer,
otherwise error will be produced.
Power ( r_base, R_exp )
- returns rarray of the r_base taken to the R_exp powers.
Power ( R_base, r_exp )
- returns rarray with each of the R_base elements taken to the r_exp power.
Power ( R_base, R_exp )
- returns rarray with R_exp powers of the according R_base elements. Input arrays should have the same size.
Power ( r_base, M_exp )
- returns matrix of the r_base taken to the M_exp powers.
Example:
Power(2.,{1. 2. 3.}) # returns {2.,4.,8.}
Power ( rarray, r_Exponent )
- returns rarray of elements taken to the specified power.
Power ( matrix, integer )
- for square matrix returns the source matrix taken to the specified power.
If the exponent is negative, the function returns the n-th power of the inverse
matrix.
Examples:
size=Power(tot_volume,1./3.) # cubic root
read matrix "LinearEquationsMatrix" # read matrix [1:n,1:n]
read rarray b # read the right-hand column [1:n]
x=Power(LinEquationsMat,-1) * b # solve system of linear equations
a=Rot({0. 1. 0.}, 90.0)
# create rotation matrix around Y axis by 90 degrees
if (Power(a,-1) != Transpose(a)) print "Wrong rotation matrix"
# the inverse should be
# equal to the transposed
rotate a_1 Power(a,3) # a-matrix to the third is
# three consecutive rotations
See also: Log
Predict( chem_array )
returns table with six chemical properties:
- "DrugLikeness : the decision value is returned for each molecule:
negative values for NON-drug-like molecules, positive for the drug like molecules.
- "MoldHf" : delta Heat of Formation :
- "MolLogP" : the octanol water transfer ( Log(Coct/Cwater) : values over 5. are hydrophobic, poorly soluble molecules,
the negative values are strongly polar molecules.
- "MolLogS" : solubility in Log( C [in moles/liter ] ). Measures the log of the concentration at which you expect
one half of your molecules in an aggregated form. E.g. -10. means virtually unsoluble, -1. means well soluble.
- "MolPSA" : estimated topological Polar Surface Area, predicted absolute polar surface area in square Angstroms.
- "Volume" : predicted absolute volume of in cubic Angstroms.
Predict( chem_array s_property )
returns rarray with the following properties :
"DrugLikeness","MoldHf","MolLogP","MolLogS","MolPSA","Volume"
see above.
An array of the property names for loaded models can be returned by
the Name ( chemical property ) function.
Examples:
Predict(Parray( "C1CCNCC1" ) )
#>T
#>-DrugLikeness-MoldHf------MolLogP-----MolLogS-----MolPSA------Volume-----
-1.006698 -11.227206 0.746186 -0.528251 12.391162 102.286931
read table mol "drugs"
add column drugs Predict(drugs.mol "MolLogP" ) name="MolLogP"
746186
function.
Probability ( s_seqPattern )
- returns the real
probability of the specified sequence pattern. To get mathematical expectation
to find the pattern in a protein of length L, multiply the probability by
L-Length( s_seqPattern).
Examples:
# chance to find residues RGD at a given position
show Probability("RGD")
# a more tricky pattern
show Probability("[!P]?[AG]")
Probability ( i_minLen, r_Score [, { identity | similarity | comp_matrix | sort } ] )
- returns the real expected probability that a given or higher score ( r_Score) might occur
between structurally unrelated proteins (i.e. it is essentially the
probability of an error). This probability can be used to rank the
results of database searches aimed at fold recognition. A better score corresponds
to a lower probability for a given alignment. The four types of scores
- no argument: alignment score
- identity: the number of identical residues * 100 and divided by the minimal sequence length
- similarity: alignment score without gap penalties *100. and divided by the minimal sequence length
- comp_matrix: alignment score without gap penalties (unnormalized)
- sort: an additional score for ranking
are given in the description of the
Score
function. Each score has a different distribution which was
carefully derived from all-to-all comparisons of sequence of protein domains.
Example:
Probability( 150, 30, identity)*55000. is the mathematical expectation of
the number of structurally unrelated protein chains of 150 residues with
30% or higher sequence identity which can be found in a search through
55000 sequences. The inverse function is
Score .
Probability ( ali_2seq, [ i_windowSize1 i_windowSize2 ] [ local ] )
- returns the rarray
of expected probabilities of local insignificance
of the pairwise sequence alignment ali_2seq.
The Karlin and Altschul score probability values (option local ) or
local ZEGA probabilities (see also
Probability(i_, r_))
are calculated
in multiple windows ranging in size from
i_windowSize1 to w_windowSize2 (default
values 5 and 20 residues, respectively). The exact formulae for the Karlin and Altschul
probabilities (option local ) are given in the next section and the ZEGA probabilities
are given in the
Abagyan&Batalov paper.
The window with the lowest probability
value is chosen in each position.
The array returned by this function can be used to color-code the regions of insignificant
sequence-structure alignment in modeling by homology. One can use the
Rarray(R_,ali_,seq_)
function to project the array onto selected sequence.
To calculate an array of mean scores for each column of a multiple sequence alignments use the Rarray( ali [ exact ] ) function.
Example:
read alignment s_icmhome+ "sx" # 2 seq. alignment
read pdb s_icmhome+"x"
p= -Log(Probability(sx))
display ribbon a_
color ribbon a_/A -Rarray(p,sx,cd59)
# Rarray projects the alignment array to the sequence
Probability ( seq_1 seq_2 [ i_windowSize1 i_windowSize2 ] )
- returns a dot matrix of probabilities of local statistical comparison between the two sequences.
This matrix contains local probability values
that two continuous sequence fragments of length ranging from
i_windowSize1 to w_windowSize2 have statistically
insignificant alignment score , which means that the match is random.
Visualization of this matrix allows to see periodic
patterns if sequence is compared with itself as well as identity
alternative alignments.
The formula is taken from the Karlin and Altschul statistics:
P= 1-exp(-exp(-Lambda*Sum(score in window)/K)), where Lambda and K
are coefficients depending on the
residue comparison matrix.
This example allows to trace the correct alignment despite an about
100 residue insertion:
read pdb sequence "2mhb"
read pdb sequence "4mbn"
m=Probability(2mhb_a 4mbn_a 7 30)
print " pProbability: Min=" Min(Min(m)) "Max=" Max(Max(m))
PLOT.rainbowStyle="white/rainbow/red"
# show probability of the chance matching (comparable to the BLAST P-value)
plot area m display color={.2 0.001} transparent={0.2 1.} link grid
# OR show -Log10(Probability)
plot area -Log(m,10) display color={0.7 3.} transparent={0. 0.7} link grid
function.
Profile ( alignment )
- creates profile from an alignment
Property ( grob option )
- returns various advanced grob properties as logical.
Available options:
- full -- dual in-out lighting of the grob
- surface -- whether only the front face of the triangles is shown (back faces culled)
- texture -- allow textures
- grid -- (requires texture). Use only the fractional part of the texture coordinates (allows repetitive pattern textures)
See also set property
Putarg( s_name s_value )
- adds a name-value pair to the list of ICM arguments. Returns no in case of error.
See Getarg .
function to change or add value to environment.
Putenv ( " s_environmentName = s_environmentValue " )
-returns a logical yes if the named shell-environment variable is created or modified.
Putenv ( )
- function to push the icm or icm-script arguments (see Getarg )
into the unix shell as shell arguments. Returns the number of set variables.
To eliminate an agrument from the list, use the
Getenv ( s_argName delete ) function.
Examples:
show Putenv("aaa=bbb") # change/add variable 'aaa' with value 'bbb' to environment
show Getenv("aaa") # check if it has been successful
See also: Existenv, Getenv, Getarg.
atomic radii (van der Waals, surface energy, and electrostatic).
Radius ( as_ )
- returns the real array of van der Waals radii of atoms in the selection.
These radii are used in the construction of the molecular surface
(skin) and can be found (and possibly redefined) in the
icm.vwt file.
Radius ( as_ surface )
- returns the rarray of the 'hydration' atomic radii.
These radii are used in construction of the solvent-accessible
(surface)
and can be found (and possibly redefined) in the
icm.hdt file.
Radius ( as_ charge )
- returns the rarray of the 'electrostatic' atomic radii.
These radii are used for building the skin (analytical molecular
surface) for electrostatic dielectric boundary calculation with
electroMethod = "boundary element".
These parameters can be found (and possibly redefined) in the icm.vwt file.
[ Random string ]
evenly distributed random function.
Random ( )
- returns a pseudo-random real in the range from 0. to 1.
Random ( i_max )
- returns a pseudo-random integer distributed in [1, i_max ]
Random ( i_min , i_max )
- returns a pseudo-random integer distributed in [ i_min , i_max ]
Random ( r_min , r_max )
- returns a pseudo-random real evenly distributed in [ r_min , r_max ]
Random ( r_min , r_max , i_n )
- returns a rarray [1: i_n ] with pseudo-random real values
distributed in [ r_min , r_max ]
Random ( r_mean , r_std , i_n , "gauss" )
- returns a rarray of i_n elements with normally distributed pseudo-random
values. The mean and standard deviation are provided as the first two arguments
Random ( r_min , r_max , i_nRows , i_nColumns )
- returns a matrix [1: i_nRows, 1: i_nColumns] with pseudo-random real values
distributed in [ r_min , r_max]
Random ( i_nRows, i_nColumns, r_min, r_max )
- returns a matrix [1: i_nRows, 1: i_nColumns] with pseudo-random real values
distributed in [ r_min, r_max ]
Examples:
print Random(5) # one of the following: 1 2 3 4 or 5
print Random(2,5) # one of the following: 2 3 4 or 5
print Random(2.,5.) # random real in [2.,5.]
randVec=Random(-1.,1.,3) # random 3-vector with components in [-1. 1.]
randVec=Random(3,-1.,1.) # the same as the previous command
randMat=Random(-1.,1.,3,3) # random 3x3 matrix with components in [-1. 1.]
randMat=Random(3,3,-1.,1.) # the same as the previous command
Random(0., 1., 10, "gauss" ) # normal distribution
Random( I_lengths s_alphabet )
- returns an sarray of random strings of lengths specified in the I_lengths array.
Strings are comprised from the characters specified in the s_alphabet. Alphabet specifications are the same as
character set specifications in regular expressions: "A-Z", "\\w", "\\dA-Fa-f", "ACGT".
Random( i_n S_words )
- returns an i_n element sarray consisting of the words specified in the S_words array repeated in random order.
Examples:
Random( Iarray(10,20) "\\dA-Z" ) # returns 10-element sarray with 20-character strings containing random digits and capital letters
Random( 100, {"rock","paper","scissors"} ) # returns 100-element sarray consisting of words "rock", "paper" and "scissors" in random order
Random( 100, Random( Iarray(10,3) "a-z" ) ) # returns 100-element sarray containing 10 random words from the "a-z" alphabet
[ rarray sequence projection | Rarrayinverse | R property transfer via alignment | Rarray properties | RarrayAlignment ]
real-array function.
Rarray ( i_NofElements )
- returns a rarray; creates zero-initialized rarray [1: i_NofElements].
You can also create an zero-size real array: Rarray(0) .
Rarray ( i_NofElements, r_Value )
- returns a rarray [1: i_NofElements ] with all elements set to r_Value.
Rarray ( i_NofElements, r_From, r_To )
- returns a rarray [1: i_NofElements ] with elements ranging from r_From to r_To.
Rarray ( r_From, r_To , r_step )
- returns rarray of equally spaced numbers from r_From to r_To. Example:
Rarray( 3.1, 15. 0.1)
Rarray ( iarray )
- converts iarray into a rarray.
Rarray ( sarray )
- converts sarray into a rarray.
Rarray ( sarray s_patternForValue1 )
- converts sarray into a rarray of 1. and 0. The value is 1. if an element if an array matches the string. E.g. Rarray({"M","W","M","E","W"},"M") # returns {1. 0. 1. 0. 0.}
Rarray ( M [ i_flag ] )
- extracts different groups of elements of the matrix and casts them into a rarray.
The possibilities are the following:
- all elements by rows (the default)
- all elements by columns
- the upper triangle,
- the lower triangle,
- the diagonal elements
- the upper triangle without diagonal elements
- the lower triangle without diagonal elements
Examples:
a=Rarray(54) # create 54-th dimensional vector of zeros
a=Rarray(3,-1.) # create vector {-1.,-1.,-1.}
a=Rarray(5,1.,3.) # create vector {1., 1.5, 2., 2.5, 3.}
a=Rarray({1 2 3}) # create vector {1. 2. 3.}
a=Rarray({"1.5" "2" "-3.91"}) # create vector {1.5, 2., -3.91}
#
M=Matrix(2)
M[2,2]=2
M[1,2]=3
Rarray( M )
Rarray( M 1 )
Rarray( M 2 )
Rarray( M 3 )
Rarray( M 4 )
Rarray( M 5 )
rarray sequence projection |
Rarray ( R_ali ali_from { seq_ | i_seqNumber } )
- returns a projected rarray. The R_ali rarray contains values
defined for each position of alignment ali_from. The function squeezes out the
values which correspond to insertions into sequence seq_, that is, in effect,
projects the alignment array R_ali onto sequence seq_.
Projecting from one sequence to another sequence via alignment.
Let us imagine that we have two sequences, seq1 and seq2 which take
part in multiple sequence alignment ali .
The transfer of property R1 from seq1 to seq2 can be achieved via two transfers :
- seq1 to ali : RA = Rarray( R1 seq1 ali r_gapValues )
- ali to seq2 : R2 = Rarray( RA ali seq2 )
Now R2 has the same dimension as seq2. Values aligned with seq1 are transferred by alignment,
other values are set to r_gapValues .
See also:
| String( s_,R_,ali_,seq_ ) | function to project strings
| | Rarray( R_seq seq_ ali_to r_gapDefault ) | function to project from sequence to alignment
| | Probability() | function
|
Reversing the order of elements in an array |
Rarray ( rarray reverse )
- converts input real array into an rarray with the reversed order of elements.
Example:
Rarray({1. 2. 3.} reverse) # returns {3. 2. 1.}
Transfer real sequence properties by alignment |
Rarray ( R_seq { seq_ | i_seqNumber } ali_to r_gapDefault )
- projects the input rarray from seq_ to ali_to (the previous function does it in the opposite direction).
The R_seq rarray contains values defined for each position of the sequence seq_.
The function fills the gap positions in the output array with the r_gapDefault values.
Combination of this and the previous functions allow you to project any numerical property of
one sequence to another by projecting the r1 property of seq1 first to the alignment and than back to
seq2 (e.g. Rarray( Rarray(r1,seq1,a,99.) , a, seq2) ).
This function can also be used to determine alignment index corresponding to a sequence index.
Example:
read alignment s_icmhome+"sh3"
t = Table(sh3)
group table t Count(Nof(t)) "n" append # add a column with 1,2,3,..
show t # t looks like this:
#>T t
#>-cons--------Fyn---------Spec--------Eps8-------n---
" " 0 1 1 1
" " 0 2 2 2
" " 0 3 3 3
" " 0 4 4 4
. 1 5 5 5
...
t2forFyn = t.Fyn == 2 # table row for position 2 in seq. Fyn
t2forFyn.n # corresponding alignment position
See also the
String( s_,R_,seq_,ali_,s_defChar ) function to project strings.
Assign arbitrary amino-acid property to a sequence |
Rarray ( sequence R_26resProperty )
- returns a rarray of residue properties as defined by R_26resProperty for 26
residue types (all characters of the alphabet) and assigned according to the
amino-acid sequence.
Example with a hydrophobicity property vector:
s= Sequence("TTCCPSIVARSNFNVCRLPGTPEAICATYTGCIIIPGATCPGDYAN") # crambin sequence
# 26-dim. hydrophobicity vector for A,B,C,D,E,F,..
h={1.8,0.,2.5,-3.5,-3.5,2.8,-.4,-3.2,4.5,0.,-3.9,3.8,1.9,-3.5,.0,-1.6,-3.5,-4.5,-.8,-.7,0.,4.2,-.9,0.,-1.3,0.}
hs=Rarray(s,h) # h-array for each sequence position
hh = Smooth(Rarray(s,h), 5) # window average
Calculating array of alignment strength values for each column |
Rarray ( ali_ [ exact | simple ] )
- returns a rarray of conservation values estimated as
mean pairwise scores for each position of a pairwise or multiple alignment.
The number is calculated as the sum of RESIDUE_COMPARISON_VALUES over n*(n-1)/2 pairs in
each column. The gapped parts of an alignment are considered equivalent to the 'X' residues
and the comparison values are taken from appropriate columns.
Option exact uses raw residue substitution values as defined in the comparison matrix
These values can be larger than one for the residues the conservation of which is important (e.g.
W to W match can be around 3. while A to A match is only about 0.5.
By default (no keyword) the matrix is normalized so that two identical residues contribute
the replacement value of 1. and two different amino acid contributed values from about -0.5 to
1. depending on the residue similarity.
If option simple is specified, each pair with identical residues contributes 1. while
each pair of different amino-acids contributes 0.. The result is divided by n(n-1)/2 ,
and the square root is taken. The values returned with the simple option are therefore
between 0. (all residues are different)
To project the resulting array to a specific sequence, use the Rarray( R_ ali_ seq_ ) function (see above).
To calculate conservation with respect to a particular set of residues in
a structure, use the Score( rs_ [ simple ] ) function.
Example:
read alignment s_icmhome+"sh3"
show Rarray(sh3)
#
a=Rarray(sh3 simple) # a number for each alignment position
# to project a to a particular sequence, do the following
b=Rarray(a,sh3,Spec) # a number for each Spec residue
String(Rarray(a, sh3, Spec ))//String(Spec) # example
generally converts things to a real.
Real ( integer )
- converts integer to real number.
Real ( string )
- converts string to real number. The conversion routine ignores trailing non-numerical characters.
Examples:
s = "5.3"
a = Real(s) # a = 5.3
s = "5.3abc" # will ignore 'abc'
a = Real(s) # the same, a = 5.3
See also: Toreal
Returns the remainder; similar to, but different from the Mod function.
| function | description | example
|
|---|
| Remainder(x,y) | brings x to [-y/2 , y/2] range | Remainder(17.,10.)=> -3.
| | Mod(x,y) | brings x to [0 , y] range | Mod(17.,10.) => 7.
|
Remainder ( i_divisor, [ i_divider ] )
- returns the integer
Remainder ( r_divisor, [ r_divider ] )
- returns the real remainder r = x - n*y where n is the integer nearest the exact value of
x/y; if | n-x/y|=0.5 then n is even. r belongs to [ -|y|/2, |y|/2 ] range
Remainder ( iarray, [ i_divider ] )
- returns the iarray of remainders (see the previous definition).
Remainder ( rarray, [ r_divider ] )
- returns the rarray of remainders.
The default divider is 360. (real) or 360 (integer) since we mostly deal with angles.
Examples:
read object s_icmhome+"crn.ob"
# transform angle to the standard
# [-180., 180.] range. (Period=360 is implied)
phi=Remainder(Value(v_//phi))
# we assume that you have two objects
# with different conf. of the same molecule
read object s_icmhome+"dcLoop.ob"
copy a_ "dcLoop2"
set object a_2.
read conf s_icmhome+"dcLoop.cnf" 2
phiPsiVec1 = Value(v_1.//phi,psi)
phiPsiVec2 = Value(v_2.//phi,psi)
# average angular
# deviation
angDev=Mean(Abs(Remainder(phiPsiVec1-phiPsiVec2)))
# cut and paste these examples into the ICM-shell
print Remainder(13,10 ) Mod(13,10 )
print Remainder(17,10 ) Mod(17,10 )
print Remainder(-13,10 ) Mod(-13,10 )
print Remainder(-17,10 ) Mod(-17,10 )
Reference( ~~seq [ ~~s_fieldName ] )
- returns the swissprot database reference if available.
It is possible to specify the requested field name; the default is "DR".
[ Replace exact | Replace simple | Replace regexp | Chemical replace ]
- text substitution function.
Replace ( s_source s_icmWildcard s_replacement )
- returns a string, which is a copy of the source string with globally substituted substrings
matching s_icmWildcard by the replacement string s_replacement.
Example:
a=Replace(" 1crn "," ","") # remove empty space
Replace ( s_source S_fromArray S_toArray )
- make several replacements in a row. The size of the two arrays must be the same.
Example which generates a complimentary DNA strand (actually there is
a special function Sequence( seq_, reverse ) which does it properly).
invertedSeq = String(0,1,"GTAAAGGGGTTTTCC") # result: CCTTT..
complSeq=Replace(invertedSeq,{"A","C","G","T"},{"T","G","C","A"})
# result: GGAAA...
Replace ( s_source S_fromArray s_replacement )
- replace several strings by a single other string. If s_replacement is
empty, the found substrings will be deleted.
Example which generates a complimentary DNA strand:
cleanStr=Replace("XXTEXTYYTEXT",{"XX","YY"},"")
Replace ( S_ s_icmWildcard s_replacement )
- returns a sarray with globally substituted elements (the original sarray remains intact).
Examples:
aa={"Terra" "Tera" "Teera" "Ttera"}
show column aa Replace(aa "er?" "ERR") Replace(aa "*[tT]" "Shm")
Replace ( S_ S_fromArray S_toArray )
- returns a sarray with multiple substitutions.
Replace ( S_ s_icmWildcard s_replacement )
- returns a sarray with multiple substitutions to a single string.
Replace a matching element of an array with another string. |
Replace( S s_completeString s_by exact ) ⇒ S_
Search a string array and find an element which matches the full s_completeString,
e.g. the "never again" element of S will only be matched with the "never againg"
string, but not with "never" .
A straight forward substitution. Replace without any interpretation of the search string. |
Replace( s|S s_whatAsIs s_byAsIs simple ) ⇒ s_|S_
In this case there is not intepretation of the query string. The first occurrence of it
is replaced with the second argument.
Example:
s="a[b]()c"
Replace(s,"[b]","()$",simple) # no intepretation
Replace using regular expressions |
Replace( s|S s_regexp s_by regexp [i_field=0] ) ⇒ s_|S_
- replace the s_regexp in the source string or array by s_byRegexp using regular expressions.
The latter is a string which may contain back-references.
Example:
read string "t.html"
s_out = Replace( s_out, "(?n)<i>(.*?)</i>", "<b>\\1</b>" regexp ) # replace italic with bold
Note that "(?n)" modifier is needed to make '.' match newline too.
Dehtml-tagging of the html text in a string or a string array:Prep work in html conversion is usually this:
<>
S = Replace( S, " ","\n", exact)
S = Replace( S, " ","\n\n", exact)
S = Replace( S, " "," ", exact)
# finally remove all tags
S = Replace( S, "<.*?>","",regexp)
<>
Example in which we remove href html tags from a column in a table :
read table html "http://pfam.sanger.ac.uk/search/keyword?query=sh2" name = "sh2t"
sh2t.ID = Replace(sh2t.ID, "<.*?>","",regexp)
Replace( chem , s_smartFROM, s_smileTO [exact] )
Finds a chemical pattern containing one of several Rn groups
and replaces the pattern to the s_smileTO pattern according to the matching
R-groups.
Note that all atoms except the ones connected to the R-groups in s_smartFROM pattern
will only match exactly the same local pattern.
The molecules will be redrawn in 2D after the replacement.
The exact option will supress the redrawing if the number of atoms in the FROM and TO
patterns is the same.
Example in which we created a newe table tt with a modified column:
read table mol "drugs.sdf"
add column tt Replace(drugs.mol, "[R1]C(=O)O","[R1]C(=O)OC")
See also:
modify chemarray s_pattern s_repl [exact]
will modify in place. This replacement can be done only for the "terminal" fragments (one attachment point)
residue selection function.
Res ( { os_ | ms_ | rs_ | as_ } [ append ] )
Res ( { rs_ [ append ] )
- selects residue(s) related to the specified objects ( os_), molecules ( ms_)
or atoms ( as_), respectively. Option append extends the selection with
the terminal residues (like Nter and Cter in peptides)
Examples:
show Res( Sphere(a_1/1/* 4.) ) # show residues within 4 A
# vicinity from the firsts one
See also: Atom ( ), Mol ( ), Obj ( ).
Res(ali ..): from sequence positions in sub-alignment to residue selection |
Res ( ali_ { seq_ | i_sequence } )
- returns residue selection corresponding to the aligned positions of the specified sequence.
The sequence can be specified by its order number in the alignment (e.g. 1crn_m in the example
below has number 1 ), or by name.
- returns the X-ray resolution in Angstroms.
Resolution ( )
- returns the real resolution of the current object.
Resolution ( os_object )
- returns the rarray X-ray resolutions for the specified objects.
The resolution is taken from the PDB files.
Examples:
sort object Resolution(a_*.) # resort objects by resolution
res=Resolution(a_1crn.)[1]
print "PDB structure 1crn: resolution = ", res, " A"
Resolution ( s_pdbFileName pdb )
- returns the real resolution of the specified pdb-file. The function returns 9.90 if resolution is not found.
Resolution ( T_factors [ R_6cell ] )
- returns the rarray of X-ray resolution for each reflection of the specified structure factor table.
The resolution is calculated from h, k, l and cell parameters taken from R_6cell or the standard defCell shell rarray.
Example:
read factor "igd" # read h,k,l,fo table from a file
read pdb "1igd" # cell is defined there
defCell = Cell(a_) # extract the cell parameters from the object
group table append igd Resolution(igd) "res"
show igd
See also: set resolution
Ring( as_ )
- returns logical yes all atoms from the selection belong to one ring
Ring( vs_ )
- returns subset of input variable selection which belongs to one ring
Ring( chemical )
- returns chemical array of ring system(s)
Ring( chemical simple )
- returns chemical array of the smallest set of smallest rings (SSSR)
Example:
show Smiles( Ring( Chemical("C(=CC=CC1C(=CC=C(C2C3)C=CC=3)C=2)C=1" ) ) unique )
show Smiles( Ring( Chemical("C(=CC=CC1C(=CC=C(C2C3)C=CC=3)C=2)C=1" ) simple ) unique )
crystallographic R-factor.
Rfactor ( T_factors )
- returns the real R-factor residual calculated from the factor-table
elements T_factors.fo and T_factors.fc. Reflections marked with T_factors.free = 1 are ignored.
crystallographic free R-factor.
Rfree ( T_factors )
- returns the real R-factor residual calculated from the factor-table
elements T_factors.fo and T_factors.fc. Only reflections marked with T_factors.free = 1 will be used.
Root-Mean-Square-Deviation function.
Rmsd ( { iarray | rarray | matrix | map } )
- returns the real standard deviation (sigma) from the mean for specified sets of numbers
Rmsd ( as_tetheredAtoms )
returns the real root-mean-square-deviation of selected atoms from the atoms to which they are tethered . The distances
are calculated after optimal superposition according to the
equivalences derived from tethers (compare with the Srmsd( as_ ) function
which does not perform superposition ).
This function also returns the transformation in the R_out array.
Rmsd ( ms_select1 ms_select2 chemical [output] )
- returns the real root-mean-square distance between two selected chemical (hetero) molecules
after an optimal chemical superposition via graph-matching is performed.
In this mode atom equivalence can be found
either by substructure search or (if none of molecules is substructure of other) by common substructure search algorithm.
Other feature of chemical mode is that it enumerates topologically equivalent atoms to find best superposition.
The maximal common substructure will be used for the calculation.
Option output will produce R_2out array with individual deviation for the matched pairs. Rmsd(R_2out) will
essentially be the overall Rmsd, but one will be able to measure the maximal and median deviation as well.
See also Srmsd( ms1 ms2 chemical ) and superimpose command.
Rmsd ( chemarray ms_select2 )
- returns real array of root-mean-square distances between each element of chemarrayand ms_select2.
Rmsd ( as_pharmTemplate as_select2 pharmacophore )
- returns the real root-mean-square distance between pharmacophore points of as_pharmTemplate and as_select2after an optimal superposition of as_pharmTemplate
See also: find pharmacophore , show pharmacophore type , makePharma
Rmsd ( as_select1 as_select2 [ { { ali_|align } | exact } ] )
- returns the real root-mean-square-distance between two aligned sets
after these two sets are optimally superimposed using McLachlan's algorithm.
Virtual atoms. Be default, the first two virtual atoms ( vt1 and vt2 ) are automatically
excluded from both selections unless the virtual option is explicitly specified.
The optional third argument defines how atom-atom alignment is
established between two selections (which can actually be of any level
atom selection `as_ , residue selection `rs_ , molecular selection `ms_ , or
object selection `os_ , see alignment options).
Number of equivalent atom pairs is saved in i_out .
Two output selections as_out and as2_out contain corresponding sets of equivalent atoms.
This function also returns the transformation in the R_out array.
See also: superimpose and Srmsd ().
Examples:
read pdb "1mbn" # load myoglobin
read pdb "1pbx" # load alpha and beta
# subunits of hemoglobin
print Rmsd(a_1.1 a_2.1 align) # myo- versus alpha subunit
# of hemo- all atoms
print Rmsd(a_1.1//ca a_2.1//ca align) # myo- versus alpha subunit
# of hemo- Ca-atoms
print Rmsd(a_1./4,29/ca a_2.1/2,102/cb exact) # exact match
rotation matrix function.
Rot ( R_12transformVector )
- extracts the 3x3 rotation matrix from the transformation vector.
Rot ( R_axis , r_Angle )
- returns matrix of rotation around 3-dimensional real vector R_axis by angle r_Angle.
To solve the inverse problem, i.e. calculate the angle from a transformation, use the
Axis( R_12 ) function which returns the angle as r_out .
Examples:
# rotate molecule by 30 deg. around z-axis
rotate a_* Rot({0. 0. 1.},30.)
Rot ( R_3pivotPoint R_3axis , r_Angle )
- returns rarray of transformation vector
of rotation around 3-dimensional real vector R_axis by angle
r_Angle so that the pivotal point with coordinates R_3pivotPoint remains static.
Examples:
# rotate by 30 deg. around {0.,1.,0.} axis through the center of mass
nice "1crn"
R_pivot = Mean(Xyz(a_//*))
transform a_* Rot(R_pivot,{0. 1. 0.}, 30.)
[ Sarray index ]
sarray function.
Sarray ( integer )
- returns empty sarray of specified dimension
Sarray ( integer s_Value )
- returns sarray of specified dimension initialized with s_Value
Sarray ( s_wildCard directory [simple|all] )
- returns sarray of file names with full path to them. With 'simple' option only file names are stored in the result array.
all toggles recursive search in sub-folders.
Example:
Sarray( "*.pdb" directory )
Sarray( "/home/user/*.ent*" directory )
if (Nof( Sarray("*.png") )==0) print "No images found"
Sarray ( string )
- converts the input string into a ONE-dimensional sarray .
To split a string into individual lines, or to split a string into a sarray of characters,
use the Split() function.
Sarray ( iarray|rarray|sarray )
- converts input arrays into an sarray.
Sarray ( rs_ [ { append | name | residue } ])
- converts input residue selection into an sarray of residue ranges, e.g.:
{"a_a.b/2:5", "a_a.b/10:15",..} .
Options:
- append : will merge residue ranges
- name : will return a string array of residueName residueNumber records
- residue : will return an array of selection strings a_obj.mol/residueNumber records
Example:
Sarray(a_/2,4:5 name)
#>S string_array
def.a1/ala2
def.a1/trp4
def.a1/glu5
Sarray(a_/2,4:5 residue)
#>S string_array
def.a1/2
def.a1/4
def.a1/5
Field(Sarray(a_/2,4:5 name),2,"/") # extract residues
#>S string_array
ala2
trp4
glu5
The l_showResCodeInSelection system logical controls if one-letter residue code is printed
in front of the residue number ( e.g. a_/^F23 instead of a_/23 ).
See also:
Sarray ( stack, vs_var )
- creates a string representation of all the conformations in the stack
Variable selection allows to choose the conformational feature you want.
Character code:
Backbone (phi,psi pairs):
- 'B': -200 < phi < -80 , 140 < psi < 200
- 'A': -101 < phi < -24 , -81 < psi < 4
- 'g': -169 < phi < -15 , -64 < psi < 54
- 'd': -211 < phi < -5 , 8 < psi < 136
- 'L': 24 < phi < 101 , -4 < psi < 81
- '_': the rest
Sidechain (chi1):
- 'M': -120 <= xi1 < 0
- 'P': 0 <= xi1 < 120
- 'T': 120 <= xi1 < 240
Example:
show Sarray(stack,v_/2:10/x*) # coding of side-chain conformations
show Sarray(stack,v_//phi,psi) # backbone conformation character coding
show Sarray(stack,v_/2:10/phi,PSI) # character coding of a chain fragment
(Note use of special PSI torsion in the last example.)
Other examples:
ss=Sarray(5) # create empty sarray of 5 elements
ss[2]="thoughts" # assign string to the second element of the sarray
sa=Sarray("the first element")
show Sarray(Count(1 100)) # string array of numbers from 1 to 100
Sarray (sarray reverse )
- Reversing the order of elements in an sarray
- converts input sarray into an sarray with the reversed order of elements.
Example:
Sarray({"one","two"} reverse) # returns {"two","one"}
See also: Iarray( I_ reverse ), Rarray( S_ reverse ), String(0,1,s)
Sarray ( sarray i_from i_to )
returns sarray of substrings from position i_from to position i_to .
If i_from is greater than i_to the direction of substrings is reversed.
Example:
a={"123","12345"}
Sarray(a,2,3)
{"23","23"}
Sarray(a,5,2)
{"32","5432"}
Getting selected entries from index table |
this function allows to get
Sarray ( T_index )
- returns sarray of index table elements
Example:
read index "myindex"
S = myindex[2:8]
S[1]
See also: write index
[ Score overlap | Score model | Score predictions | Score sequence | Score conservation | Score alignment ]
function.
A measure of overlap between two arrays |
Score ( R_1, R_2 ) ⇒ r_overlapMeasure
- returns the real measure of overlap between two real arrays.
This measure varies between -1 and 1..
(all values of R_1 are smaller than all values of R_2) and +1.
(all values of R_1 are greater than all values of R_2)
and may serve as a ranking criterion.
Examples:
show Score({1. 2. 5. 3.} {3. 1.5 1.5 5.}) # 0. perfectly overlapping arrays
show Score({2. 5. 3.} {1. 1.5 0.5}) # 1. no overlap R_1 > R_2
show Score({1. 1.5 0.5} {2. 5. 3.}) # -1. no overlap R_2 > R_1
show 1.-Abs(Score({1. 3. 2.5} {2. 5. 3.})) # relative overlap between R1 and R2
Quality measures of a regression or classification model. |
Score ( model [ test | full ] s_stats ) ⇒ r_PredictionQuality
Categorical or class prediction (e.g. Bayesian classifier). If each data record has a label which can
be either positive or negative (say, 1, or -1) then the success of a prediction method
can be measured by the following measures:
| measure | abbreviation/formula | description
|
|---|
| "tpos" | TP | number of true positives
| | "fneg" | FN | number of false negatives
| | "fpos" | FP | number of false positivers
| | "tneg" | TN | number of true negatives
| | "accuracy" | Q=(TP+TN)/(TP+TN+FP+FN) | fraction of correctly predicted label assignments
| | "sensitivity" | TP/(TP+FN) | fraction of correction predicted positive labels
| | "specificity" | TN/(TN+FP) | fraction of correction predicted negative labels
| | "mathews" | (TP*TN-FN*FP)/Sqrt((TP+FN)(TP+FP)(TN+FN)(TN+FP)) | Mathews correlation
| | "precision" | PR=TP/(TP+FP) |
| | "recall" | RE=TP/(TN+FP) | same as sensitivity
| | "f1" | 2*PR*RE/(PR+RE) |
|
Note that only "acuracy", and "mathews" are overall measures symmetrical with respect
to the label. Frequently a method is characterized by an area under a recall - precision curve.
Quality measures to evaluate a regression method predicting numerical values, e.g. Partial Least Squares, or Kernel Regression.
| measure | formula | description
|
|---|
| "r2" | r=Mean((X-))/(Stdev(X)*Stdev(Y)) ; r2=r*r | correlation squared
| | "rmse" | Sqrt(Sum((Xpred-Xobs)^2 )/N) | root-mean-squared error
| | "expavg" | |
|
Scoring prediction quality from an array of errors and predicted scores |
Score ( R_En, R_Dn, wE, wD ) ⇒ r_PredictionQuality
Evaluates Q (quality)-value of predicted "energies" R_En for n - states, by comparing predicted energies with the deviations R_Dn from the correct answer.
In essence we are doing the following:
- starting from distances (e.g. RMSD) from the correct answer Di (Di >=0.)
- calculating their well-behaved and inverted version, exp( -w*D ) [0., 1.]
- calculating the normalized Boltzmann average if the previous similarity measure
- taking -Log of the previous average
For example, if you predicted n conformations with energies
E[n] and calculated RMSD deviations D[n] for each of those conformations from the correct conformation, the
quality of your prediction will be calculated by this function.
The Q-value is calculated as follows:
Q = - Log( Sum( exp(- wE#(Ei-Emin) -wD*Di )) / Sum(exp(- wE#(Ei-Emin))) )
The best Q -value is 0. (it means that zero deviation (Di=0.) correspond to the best energy and the energy gap is large.
The weighting factors wE and wD can be used to change the relative contributions of energies and deviations.
Aligning and scoring pairwise sequence alignment |
Score ( sequence1, sequence2 )
- returns the real score of the Needleman and Wunsch alignment.
Each pair of aligned residues contributes according to the current
residue comparison table,
which is normalized so that the average diagonal element is 1.
Insertions and deletions reduce the score according to the gapOpen
and gapExtension parameters.
Approximately, the score is equal to the number of residue identities.
To calculate an array of mean scores for each column of a multiple sequence alignments use the Rarray( ali [ exact ] ) function.
i_out returns the number of identical residues.
Examples:
read sequence msf s_icmhome+"azurins.msf"
a = Score( Azur_Alcde Azur_Alcfa ) # it is around 90.
See also: Distance( ).
Conservation score from an alignment projected to a structure |
Score ( rs, [ simple | comp_matrix | info ] )
- returns the rarray of alignment-derived conservation values for the selected residues.
For each residue Ri in the residue selection rs_ the following steps are taken:
- a column is extracted from a linked N-sequence alignment ( see the link command )
- Si = Sum( Cij )/N where j=1,..N and Cij is the residue comparison value
- simple mode: Cij = 1. for two identical residues and 0. otherwise
- comp_matrix (the default) mode: Cij is taken from a normalized comp_matrix . Its elements
are calculated as Cij_norm = Cij/Sqrt(Cii*Cjj) .
- info (inverse information entropy mode): Cij = 1./(1.+Entropy), where Entropy= -Sum((fj)Log(fj)). The elements after normalization range from 0. (no conservation,
1. conservation).
The default mode shows positions with residues of the same type as more conserved than positions
with residues of different types.
Example in which we compare conservation on the surface and in the core:
read alignment s_icmhome+"sh3.ali"
read pdb "1fyn"
make sequence a_a
group sequence sh3
align sh3
display ribbon
color ribbon a_a/A Score( a_a/A simple )
show surface area
show Mean( Score( Acc(a_a/*) ) ) # conservation score for the surface
show Mean( Score( a_a & !Acc(a_/*)))# conservation score for the buried
Scoring an existing alignment |
Score ( ali_, [ { identity | similarity | comp_matrix | sort } ] )
- returns the real score of the given alignment calculated by different methods:
- no second argument :
the straight Needleman and Wunsch score: aligned residues score according to the
residue comparison table, gaps according to the gapOpen and gapExtension parameters.
- identity
the number of identical residues in the alignment divided by the smallest sequence length
and multiplied by 100 %.
- comp_matrix
the alignment score without the gap component.
It contains only the total score of the aligned residues calculated from the
residue comparison table and does not include penalty term.
- similarity
the alignment score without the gap component multiplied by 100. and divided by the smallest sequence length.
- sort
a score occasionally used for ranking/sorting the alignments in fold recognition.
Currently it is equal to the comp_matrix_score - 1.3*totalGapPenalty
Score ( i_minLen, r_Probability [, { identity | similarity | sort } ] )
- returns the real threshold score at a given r_Probability level
of occurrence of alignment with a protein of unrelated fold. The threshold is related to
the corresponding method of the score calculation (see above).
For example,
Score( 150, 1./55000.,identity)
gives you the sequence identity percentage for sequences of
150 residues at which only one false positive is expected in a search through the
Swissprot database of 55000 sequences.
See also the inverse function: Probability .
[ Select break | Select fix | Select neighbors | Select by nmembers | Select graphical | Select expand | Select by atom property | Select_projection | Select_by_text | Select_by atom numbers | Select_patching | Select_lists | Select_by_sequence | Select by center of mass ]
Selection of atoms according to their coordinates or properties, transferring a selection
to another object, or selecting by relative object-specific atom numbers stored in an integer array, or by sequence distance.
- : Select()=>
- : Select( )=> # conditions: "c" from x,y,z,b,o,c,a,u,v,w,n e.g. Select(a_ "b>80")
- : Select( I_indeces ) =>
- : Select( hydrogen|hbond|smooth ) =>
- : Select( fix|unfix) =>
- : Select( bond ) =>
- : Select( )=>
- : Select( )=>
- : Select( )=> # e.g. Select(a_/1:2,4:6 2)=>a_/1:6
- : Select( margin, )=>
- : Select( error )=>
- : Select( ) =>
- : Select( [ [r_min_seqid(0.2) [r_mx_length_dist(0.3)]]] ) =>
Select atoms forming an abnormally long covalent bond |
Select( as delete | error ) ⇒ as_bad_atom_pairs
this function returns pairs of atoms (i) connected with abnormal bond lengths, and, (ii) breaks in the backbone of
a polypeptide (even if a 'C' carbon and the following 'N' are not bound covalently).
Example in which we find residues flanking the missing loop:
read pdb "2pe0"
display ribbon
display residue label Res(Select(a_ delete ))
Select atoms on rotatable (or non-rotatable) branches. |
Select ( as fix | unfix )
select atoms of the fixed or rotatable branches, for the fix or unfix options, respectively.
Select atoms with a certain number of covalently bonded neighbors. |
Select( as bond i_NofBondedAtoms )
- returns a sub-selection of as with atoms having the specified number of covalent neighbors.
Example:
build smiles "CCO"
show Select(a_ bond 1) # selects all terminal hydrogens
show Select(a_ bond 2) # selects oxygen that is bonded to C and H
show Select(a_ bond 3) # no atom has three neighbors:
show Select(a_ bond 4) # carbons have 4 neighbors
See also: selecting by SMARTS patterns
Select by number of sub-elements. |
This functions allow to select objects according to the number of molecules in them, and molecules according to the number of residues in them.
Select ( os "n==nofMolecules" )
selects objects by number of molecules in them
Select ( ms "n==nofResidues" )
selects molecules by number of residues in them
Allowed comparison operations : ==, >, >=, <, <=, != .
Example:
Select( a_A,N "n==1" ) # all single residue amino or nucl molecules
Select( a_A,N "n>1" ) # all longer residue amino or nucl molecules
Select displayed or explicitly selected atoms |
Select ( [ residue | molecule | object ] )
- returns either selected ( as_graph ) or displayed atoms ( a_*.//DD ).
By providing the argument, you can change the selection level.
Example:
display skin Select(residue)
Expand selection to the bonded terminal atoms: hydrogens, polar hydrogens or all. |
Select ( as_source [ hbond | hydrogen | smooth ] )
- returns the source selection expanded to single covalently bonded atoms, e.g. hydrogens.
The returned selection is at the atomic level.
Options:
- hydrogen : adds all attached hydrogens
- hbond : adds all polar (non carbon connected, sorry, no aromatic hbonds) hydrogens
- smooth : adds all bonded terminal atoms (hydrogens or heavy atoms).
Example:
Select(a_/tyr/o* hbond ) # adds hh to this selection
Select(a_/tyr/cb hydrogen ) # adds hb1 and hb2
Select(a_//ca,c,n smooth ) # carbonyl oxygen and N-terminal hydrogens
Select by coordinates, bfactor, occupancy or by user field |
Select ( as_ s_condition [ r_Value] )
- returns a sub-selection of
atom selection as_ according to the specified condition s_condition.
Three example conditions:
"X >= 2.0" , "Bfactor != 25." , "charge == 0." . Allowed properties and their aliases (case does not matter, the first character is sufficient) are as follows:
- x,y,z atomic coordinates ("x","y","z")
- bfactor ("bfactor","b","B")
- occupancy ("o")
- charge ("charge","c","q")
- accessible surface area ("area","a")
- user-field ("u") which can be set with set field and extracted with the Field function.
- residue user-fields: "u","v","w" for the 1st, 2nd and 3rd field, respectively.
- number of sub-components, number of molecules in one object, or number of residues in one molecule, see above.
Note: do not forget to calculate surface in advance with the show area command.
Allowed comparisons: (== != > < >= <=).
The value can either be specified inside the string or used as a separate argument r_Value.
See also the related functions:
Area, Bfactor, Xyz, Charge, Field .
Examples:
build string "se glu arg"
show Select(a_//* "charge < 0.")|Select(a_//c* "x> -2.4")
show Select(a_//c* , "x>", -2.4)
show Select(a_/* , "w>3.") # 3rd res. user field greater than 3.
Note:
atoms with certain Cartesian coordinates can also be selected by multiplying selection to a box
specified by 6 real numbers {x,y,z,X,Y,Z}, e.g.
show a_//* & {-1.,10.,2.,25.,30.,22.} or
a_//* & Box( ).
See also: display box and the Box function.
Select an equivalent selection in a different object |
Select ( as_sourceSelection os_targetObject )
- returns the source selection as_sourceSelection from a source object which is
transferred to another object ( os_targetObject ).
The two objects must be identical in content. Example:
build string "ASD"
aa = a_/2/c* # selection in the current obj a_
copy a_ "b" # a copy of the source object
bb = Select(aa,a_b.) # selection aa moved to a_b.
Select residues by a string array of selection expressions |
Select ( os_sourceObject S_residueSelStrings )
- returns residue selection of the residue selection strings which can be returned with the
Sarray ( rs_ residue ) function. The object name can be skipped. E.g.
Select( a_2ins. {"a/14","b/14"} )
Select residues by a string array of selection expressions |
Select ( os_sourceObject I_atomNumbers )
- returns atom selection of relative atom numbers in specified object os_sourceObject.
The iarray can be generated with the Iarray ( as_ ) function.
This function allows to pass selections between ICM sessions.
Add small unselected residue ranges to a fragmented residue selection |
Select ( rs_fragmented_selection [smooth|margin] i_gapSizeToHeal )
This function by default (or with option smooth) will take a source residue selection,
identify all gaps of size below the specified parameter and
will healing those gaps by adding them to the selection.
For example, if you have a residue selection, e.g. a_/1,2,5,6
Select(a_/1,2,5,6 2 ) # residues 3 and 4 will be added
a_/1,2,3,4,5,6
Option margin will simply expand the source selection by the specified margin size.
Select atoms interacting with a given selection |
Select ( as_source "vw,14,hb,el,cn,tz" )
Interacting atoms.selecting atoms interacting with the source atoms according to a particular energy term.
It is required that the source atoms are in the current ICM object and show energy command has
been used at list once. See example below.
Tether destination atoms.In case of tethers ("tz") this function
returns a selection of the static destination atoms (same as a_//Z ).
Example:
build string "se ala his trp"
copy a_ "tz" tether # make a copy object and tether atoms to a_tz.
show energy "vw,hb"
aca = a_//ca # selection of Ca atoms
Select( aca "vw,hb" )
Obj(Select( aca "tz" ))
2 a_tz. Type: ICM Mol: 1 Res: 1 def
Select by alignment distance and sequence length mismatch |
Select(seq [ ms_where [r_min_seqid(0.2) [r_mx_length_dist(0.5)]]] ) ⇒ ms_sim_seq
- returns molecular selection of all chains with sequences similar to seq .
Arguments and options:
- seq : a shell sequence or a dynamically generated sequence, e.g. Sequence(a_1.a)
- ms_where : a subset of molecules for the sequence search. The default value is all molecules of all objects
- r_min_seqid : is sequence identity threshold (0. to 1.) 1. for identical sequences, and 0. unrelated sequences.
- r_mx_length_dist :the length distance is defined as the length_difference / longer_sequence_length and can only be a number between 0. and 1. (0. identical lengths, 1. no length restrictions). To ignore length filter, specify 1. or a larger number.
Example:
read pdb "1crn"
read pdb "2ins"
Select( Sequence( a_2.2 ) )
display ribbon a_
color ribbon magenta Select( Sequence( a_2.2 ) a_*. 0.2 0.3 )
Selecting residues by centers of mass |
To select the closest residue from a center of mass of one selected residue, use the Sphere function with a coordinate matrix argument.
We need to follow these steps:
- Function Xyz(as_res) will return a set of coordinates (as a Nx3 matrix) for the selected residue atoms. Use as_res & a_*.//!h* for heavy atoms only.
- Function Mean(Xyz(as_res)) to get a single vector with the center of mass
- Use Sphere( Mean(Xyz(as_res)) as_targetSelection & ! as_res ) to select atoms at a certain distance from the center of mass.
E.g.
read pdb "1crn"
display
center_of_mass = Mean(Xyz(a_/44))
display xstick magenta Res(Sphere( center_of_mass , a_1. & a_/!44 , 7.5) )
# Res is added to select all residue atoms once an atom is inside the sphere
To find the closest residue to residue 44 in the above example, use the table approach, e.g.
read pdb "1crn"
display
center_of_mass = Mean(Xyz(a_/44))
nb = Res(Sphere( center_of_mass , a_1crn. & a_1crn./!44 , 7.5) )
if(Nof(nb)>0) then
group table t Rarray(0) "dist" Sarray(0) "sel"
for j=1,Nof(nb)
add t
cmj = Mean(Xyz(nb[j]))
t.dist[j] = Distance( center_of_mass, cmj )
t.sel[j] = String(nb[j])
endfor
sort t.dist # the smallest distance is on top ([1]) now
s_closest_res = t.sel[1]
endif
A faster implementation of the same task with the Group function with the "mean" argument.
This solution can also be modified to use the closest atom (instead of the center of mass) by using "min".
[ Reverse complement | Sequence array ]
function.
Sequence ( as_select )
- returns sequence extracted from specified residues.
Sequence( s [ nucleotide | protein ] )
- converts a string (e.g. "ASDFTREW") into an ICM sequence object.
By default the type is "protein". To reset the type use the
set type seq { nucleotide | protein } command.
Examples:
seqA = Sequence( a_1./15:89 ) # create sequence object
# with fragment 15:89
show Align(seq1, Sequence("HFGD--KLS AREWDDIPYQ")
# non-characters will be squeezed out
a=Sequence("ACTGGGA", nucleotide)
Type(a , 2) # returns the type-string :
nucleotide
Sequence ( ali_ )
- returns a chimeric sequence which represents the strongest character in every
alignment position.
Sequence ( profile_ )
- returns a chimeric sequence which represents the strongest character in every
profile position.
reverse complement dna sequence function |
Sequence ( seq_DNAsequence reverse )
- returns the reverse complement DNA sequence:
nucleotide |complement
_____________________|__________
|
A = Adenosine | T (replace by U for RNA)
C = Cytidine | G
G = Guanosine | C
T = Thymidine | A
U = Uridine | A
R = puRine (G A) | Y
Y = pYrimidine(T C) | R
K = Keto (G T) | M
M = aMino (A C) | K
S = Strong (G C) | S
W = Weak (A T) | W
B = !A (G T C) | V
D = !C (G A T) | H
H = !G (A C T) | D
V = !T (G C A) | B
N = aNy | N
Sequnce( S )
- converts sarray of sequence strings to protein sequence parray
Example:
add column T Sequence( {"MISLIAALAVDRVIGPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR", "STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILTF"} ) name="seq"
add column T Length(T.seq) name="len"
set name T.seq {"6dfr", "8adh"}
sq1 = T.seq[1]
See also: sequence parray.
Shuffle ( I | R | S ) ⇒ shuffled_array
Shuffle ( string ) ⇒ shuffled_string
Shuffle ( seq ) ⇒ shuffled_sequence
randomly change order of elements of an array or a sequence of characters.
Example:
a={1 2 3}
Shuffle(a) # {2 1 3}
Shuffle(a) # {3 1 2}
Shuffle("this") # won't tell you..
transfer-of-sign function.
It returns the value (or values) of sign { -1.|0.|+1.} of its argument.
Sign ( real )
- returns real sign of the argument.
Sign ( integer )
- returns integer .
Sign ( iarray )
- returns iarray.
Sign ( rarray )
- returns rarray.
Sign ( map )
- returns map with -1., 0., 1. values.
Examples:
Sign(-23)
-1
Sign(-23.3)
-1.
Sign({-23,13})
{-1,1}
Sign({-23.0,13.1})
{-1.,1.}
sine trigonometric function.
Arguments are assumed to be in degrees.
Sin ({ real | integer } )
- returns the real sine of its real or integer argument.
Sin ( rarray )
- returns the rarray of sines of rarray elements.
Examples:
print Sin(90.) # equal to 1
print Sin(90) # the same
print Sin({-90., 0., 90.}) # returns {-1., 0., 1.}
hyperbolic sine function.
Sinh ( { real | integer } )
- returns the real hyperbolic sine of its real or integer argument.
Sinh(x)=0.5( eiz - e-iz )
Sinh ( rarray )
- returns the rarray of hyperbolic sines of rarray elements.
Examples:
print Sinh(1.) # equal to 1.175201
print Sinh(1) # the same
print Sinh({-1., 0., 1.}) # returns {-1.175201, 0., 1.175201}
site selection function
Site ( s_siteID [ ms_ ])
- returns the iarray of the site numbers in the selected molecule.
The default is all the molecules of the current object.
Example:
nice "1est" # contains some sites
delete site a_1 Site("cat",a_1)
Slide( )
- returns a compact binary representation of the entire graphical view (also known in ICM as a slide). Slides
include the following:
- molecular representations, labels, sites and colors for multiple objects
- grobs and their display attributes
- the view point, zoom and scale
- key graphics preferences
- displacements of residue labels
- the background color.
In addition slides may contain window layout information, sufficient to restore the view
which was used when the slide was created.
The data is packed into a single-element parray of a view type.
These "slides" can be written and read as parts of the .icb project files with the read binary command.
To display the view use the display parray_slide command, e.g.
slide1 = slideshow.slides[1]
display slide1
Slide( gui )
- returns a slide containing only the current window layout information.
See also: String slide gui, add slide.
convert chemical structure into a Smiles string.
Smiles ( as_ )
Smiles ( chem [unique] [cartesian] )
- returns a smiles - string with the text representation of
the chemical structure of a selected fragment or a chemical array.
The unique option will make that string independent of the order atoms in the molecule.
The cartesian option will adds 2D or 3D coordinates at the end of the result smiles string. That coordinates will be
used in Chemical function
Example:
read object s_icmhome + "biotin.ob"
s_smiles = Smiles( Chemical( a_ exact hydrogen ) cartesian ) # coordinates will be preserved
read mol input=String( Chemical( s_smiles )) #
Srmsd( a_1. a_2. chemical )
See also: build smiles, String( as_ ) - chemical formula.
[ Smooth | Smoothrs | Smooth alignment | Smooth map ]
sliding window averaging, convolution, 3D-Gaussian smoothing, map smoothing
and function derivatives.
Smooth ( R_source, [ i_windowSize ] )
- returns the window-averaged rarray.
The array is of the same dimension as the R_source and
i_windowSize is set to windowSize
by default. An average value is assigned to the middle element
of the window. i_windowSize must be an odd number.
At the array boundaries the number of averaged elements is gradually reduced to one element,
i.e. if i_windowSize=5, the 3rd element of the smoothed array will get
the mean of R1,R2,R3,R4,R5, the second element will get the mean of R1,R2 and R3,
and the first element will be set to R1.
Smooth ( R_source, R_weightArray )
- returns the rarray of the same dimension as the R_source,
performs convolution of these two arrays. If R_weightArray contains
equal numbers of 1./ i_windowSize, it is equivalent to the
previous option. For averaging, elements of R_weightArray
are automatically normalized so that the sum of all elements in the
window is 1.0.
Normalization is not applied if the sum of elements
in the R_weightArray is zero. Convolution with such an array
may help you to get the derivatives of the R_source array. Use:
{-1.,1.}/Xstep # for the first derivative
{1.,-2.,1.}/(Xstep*Xstep) # for the second derivative
{-1.,3.,-3.,1.}/(Xstep*Xstep*Xstep) # for the third derivative
# ... etc.
Examples:
gauss=Exp( -Power(Rarray(31,-1.,1.) , 2) ) # N(0.,1.) distribution on a grid
x = Rarray(361,-180.,180.) # x-array grows from 0. to 180.
a = Sin(x) + Random(-0.1,0.1,361) # noisy sine
b = Smooth(a,gauss) # gauss averaging
# see how noise and smooth signals look
plot x//x a//b display {-180.,180.,30.,10.}
# take the first derivative of Sin(x)
c = Smooth(Sin(x),{-1., 1.}) * 180.0 / Pi
# plot the derivative
plot x c display {"X","d(Sin(X))/dX","Derivative"}
Smooth: three-dimensional averaging of residue properties |
Smooth ( rs_, R_property, r_smoothRadius )
- Gaussian averaging of property array R_property of residues rs_ .
The averaging is performed according to the spatial distance between residue Ca atoms.
The function returns the rarray of the residue property AVERAGED in 3D using spherical Gaussian with
sigma of r_smoothRadius. Each residue contributes to the smoothed property with
the weight of exp(-Dist_i_j2/ r_smoothRadius2).
The inter-residue distances Dist_i_j are calculated between atoms carrying the residue label
(normally a_//ca).
These atoms can be changed with the
set label command.
Array R_1 is normalized so that the mean value is not changed.
The distances are calculated between
Examples:
nice "1tet" # it is a macro displaying ribbon++
R = Bfactor(a_/A ) # an array we will be 3D-averaging
color ribbon a_/A Smooth(a_/A R 1.)//5.//30. # averaging with 1A radius
color ribbon a_/A Smooth(a_/A R 5.)//5.//30. # with 5A radius
color ribbon a_/A Smooth(a_/A R 10.)//5.//30. # with 10A radius
# 5.//30. are appended for color scaling from 5. (blue) to 30.(red)
# rather than automated rescaling to the current range
set field a_/A Smooth(a_/A R 5.)
show Select( a_/A "u>30." ) # select residues with 1st field > 30.
Smooth: expanding alignment gaps |
Smooth ( ali_, [ i_gapExpansionSize ] )
- returns a transformation of the initial alignment in which every gap is widened by the
i_gapExpansionSize residues. This transformation is useful
in modeling by homology since the residue pairs flanking gaps usually
deviate from the template positions.
The default i_gapExpansionSize is 1 (the gaps are expanded by one residue)
Smooth: transforming three-dimensional map functions. |
Smooth ( map_ , [ "expand" ] )
weighted 3D-window averaging
Smooth( map_ )
- returns map with averaged map function values.
By default the value in each grid node is averaged
with the six immediate neighbors (analogous to one-dimensional averaging
by Smooth(R,{1.,2.,1.}) . By applying Smooth several times
you may effectively increase the window.
This operation may be applied to "ge","gb","gs" and electron density maps
low-values propagation
Smooth( map_ "expand" )
- returns map in which the low values were
propagated in three dimensions to the neighboring nodes. This trick
allows to generate more permission van der Waals maps.
This operation may be applied to "gh","gc" and electron density maps.
Examples:
m_gc = Smooth(Smooth(m_gc "expand"), "expand" )
See also: map .
functions to connect to a Molcart server or database file and run SQL queries.
This function has the following properties:
- it works with the current connection
- requires a running Molcart server with a database
- the record columns from the database are converted into the corresponding ICM types.
Sql ( connect s_host s_loginName s_password s_dbName )
- returns the logical status of connection to the specified server.
The arguments are the following:
- s_host (default "localhost") - the host name
- s_loginName (default "root")
- s_password - the database password
- s_dbName - the database name
Sql ( s_SQLquery )
- returns the table of the selected records.
Some SQL commands are not really queries and do not return records, but rather
perform certain operations (e.g. insert or update records, shows statistics).
In this case an empty table is returned.
An example:
if !Sql( connect "localhost","john","secret","swiss") print "Error"
id=24
T =Sql( "SELECT * FROM swissprothits WHERE featureid="+id )
sort T.featureid
web T
# Another example
tusers = Sql("select * from user where User=" + s_usrName )
Sql(off)
Sql ( off )
- disconnects from the database server and returns the logical status.
See also: molcart, query molcart
square root function.
Sqrt ( real )
- returns the real square root of its real argument
Sqrt ( rarray )
- returns rarray of square roots of the rarray elements.
Sqrt ( matrix )
- returns matrix of square roots of the matrix elements.
Examples:
show Sqrt(4.) # 2.
show Sqrt({4. 6.25}) # {2. 2.5}
sphere selection function.
It returns a selection containing atoms, residues or molecules within a
certain radius around the initial selection. It returns atom selection
which can be then converted into residue and molecules with the Res and
Mol functions respectively.
The default value is defined by the selectSphereRadius .
ICM-shell variable which is equal to 5.0 A by default.
Sphere (as_source| grob|R_xyz|M_xyz [as_whereToSelect] [radius(5.)] ) ⇒ selection
Sphere (as_source|M_xyz as_whereToSelect radius object|molecule|residue ) ⇒ os|ml|re
this function returns a selection of atoms in a certain
vicinity of the following set of points:
- a group of atoms ( as_source )
- any vertex point of a grob (i.e. graphical object)
- a point in space ( R_xyz)
- a group of points in space ( M_xyz) (e.g. see the Xyz function)
The atoms will be searched in the specified selection as_whereToSelect
if the second selection is explicitly specified.
If only one atom selection is specified,
the atoms will be selected from the same object.
The function can be much accelerated if you specify the desired
level of the resulting selection
explicitly (e.g. molecule ,or residue, or object in the second function template). For example, if you just want to know
molecules around a selection, you can say Sphere( a_1 a_2 6. molecule )
The selection level functions ( Res , Mol , and Obj )
can also be used to convert the atom selection into residues, molecules or objects, respectively
(e.g. Res(Sphere(a_/15,4.)) ), if speed is not an issue or the explicit level option is not available.
For example, selection
show Sphere( a_subA/14:15/ca,c,n,o , 5.2)
Res(Sphere( a_1.2 a_2.)) # residues of a_2. around ligand a_1.2
Sphere( a_1.2 a_2. 7. residue) # same but much faster
Adjusting for the van der Waals radii using the sign of the radius. Sphere can also correct for the van der Waals radii if you specify the negative radius.
For example, Sphere( a_//a1 a_//a2 , -1.2 ) means that the
interatomic_distance - (R(a1) + R(a2)) will be compared with 1.2
It means that the argument of -1.2 is equivalent to the distance of 1.2+1.6+1.6 = 4.4 for two carbons )
The negative sign just flags the program to use the adjustment.
function to form SOAP request or to parse a result from the server.
A SOAP message is special XML text which contains :
- SOAP method name and a namespace
- method arguments
SoapMessage( s_methodName s_methodNamespace )
returns soapMessage object with specified method name.
SoapMessage( soapMessage [ s_argumentName argumentValue ] ... )
adds a number of name/values pairs to the exiting soap message and returns
a new soap message as a result
SoapMessage( s_xmlSource )
parses xml source and returns soapMessage object.
The following example form a SOAP request to the google search service.
# create a message with soap method 'doGoogleSearch'
req = SoapMessage( "doGoogleSearch","urn:GoogleSearch" )
# add method arguments
req = SoapMessage( req, "key","btnHoYxQFHKZvePMa/onfB2tXKBJisej" ) # get key from google
req = SoapMessage( req, "q", "molsoft" ) # search 'molsoft'
# some other mandatory arguments of 'doGoogleSearch'
req = SoapMessage( req, "start" 0, "maxResults" 10 )
req = SoapMessage( req, "filter", no, "restrict", "", "safeSearch", no )
req = SoapMessage( req, "lr", "", "ie" "latin1", "oe", "latin1" )
HTTP.postContentType = "text/xml"
read string "http://api.google.com/search/beta2" + " " + String(req)
# parse the result and check it for errors
res = SoapMessage( s_out )
if Error(res) != "" print "Soap error: ", Error(res)
See SOAP services for more information.
function to return the sorted version of array.
Sort ( sarray|iarray|rarray|chem-array [reverse] )
- returns the sorted array. Option reverse toggles the sorting order.
Examples:
count_unique=Nof(Sort(Unique({1, 11, 7, 2, 2, 7, 11, 1, 7}))) # counts unique elements
See also: Unique( ), sort.
[ Split tree | Split regexp | Split multisep | Split chemical ]
function.
Split ( s_multiFieldString, s_Separators )
- returns sarray of parts of the input string separated by s_Separators.
Multiple spaces are treated as one space, while all other multiple separators
lead to empty fields between them. If s_Separator is an empty string
(""), the line will be split into individual characters. To split a multi-line
string into individual lines, use Split( s_, "\n" ).
Examples:
lines=Split("a 1 \n 2","\n") # returns 2-array of {"a 1" " 2 "}
flds =Split("a b c") # returns 3-array of {"a" "b" "c"}
flds =Split("a b:::c",":") # returns 4-array of {"a b","","","c"}
resi =Split("ACDFTYRWAS","") # splits into individual characters
# {"A","C","D","F",...}
See also: Field( ).
Split ( s_multiFieldString s_separator exact )
- returns sarray
of fields separated exactly by s_separator
Split tree cluster by threshold or number of clusters. |
Split( table.cluster, [r_threshold]|[i_numberOfClusters] )
Returns iarray of cluster numbers for each row.
Example:
cl = Split( t.cluster, Max( t.cluster )/2 )
Split by a regular expression |
Split ( s_source, s_separator, regexp )
- returns an sarray with the source string separated by regular expression
Useful separators:
- '\s+' splits by single or multiple occurrence of spaces and tabs (brackets, pluses, quotes etc. remain)
- '\W+' splits into words ('\W+' skips brackets, quotes etc. and matches the entire inter-word space)
- '[\n\r]' (new line) splits a multi-line string into individual lines
Examples:
Split("a b \t\tc", "\s+", regexp) # returns 3-array of {"a" "b" "c"}
Split("a_asd_b_awe_c","_a.._", regexp) # returns { "a","b","c" }
Split ( S_source, s_separator1, s_separator2 [regexp|exact] ) ⇒ T_table
- takes a sarray as an input. Each entry of sarray has the following syntax:
namesep2valuesep1namesep2value ...
where name and value can be any text which does not contain sep1 or sep2
returns a table with columns name1, name2, etc. filled with corresponding values.
Example:
Split( { "a=1;b=2", "a=3;c=5" "d=1;b=1;e=7" } ";" "=" )
See also: Sum-multisep
Split a chemical into individual molecules |
Split ( chemical, mol ) ⇒ chemarray
Splits a single multimolecular entry (e.g. a compound plus water molecules) into individual
molecules. It always return at least one element.
add column t Split( Chemical( "O=O.NN" ) )
See also: Sum chemical other chemical functions
"static" root-mean-square deviation function. Calculates deviation without superposition.
Srmsd ( ms_select1 ms_select2 chemical [output] )
Srmsd ( ms_select1 ms_select2 as_subselect1 chemical )
- returns the real root-mean-square distance between two selected chemical (hetero) molecules
according to the optimal chemical match but without 3D superposition.
With the third selection argument, the deviation will be calculated only for the as_subselect1 atoms while the equivalence pairs are established using the first two selections.
Option output will produce R_2out array with individual deviations for the matched pairs.
See also: Rmsd( ms1 ms2 chemical ) and superimpose
command.
Srmsd ( as_select1 as_select2 [{ align | ali_ } | auto|chemical|exact|pharmacophore|type|virtual|matrix] )
- returns real value of root-mean-square deviation (returns a matrix with the matrix option ).
Similar to function Rmsd, but works without optimal superposition,
i.e. atomic coordinates are compared as they are without modification.
Number of equivalent atom pairs is saved in i_out
(see alignment options).
Virtual atoms. Be default, the first two virtual atoms ( vt1 and vt2 ) are automatically
excluded from both selections unless the virtual option is explicitly specified.
Two version of the matrix option exist:
Srmsd( as1 as2 matrix ) ⇒ M_dist
aligns amino chains by residue number and returns a [ nofMol1:nofMol2 ] matrix.
Srmsd( as1 as2 chemical matrix ) or Srmsd( as1 as2 matrix chemical ) ⇒ M_dist
performs a chemical superposition
Examples:
superimpose a_1.1 a_2.1 # two similar objects, each
# containing two molecules
print Srmsd(a_1.2//ca a_2.2//ca) # compare how second molecule
# deviates if first superimposed
Srmsd ( as_select )
- returns real root-mean-square length of absolute distance restraints
( so called, tethers ) for the tethered atoms in ICM-object.
Equivalent to
Sqrt(Energy("tz")/Nof(tether)) after
show energy "tz" .
Optimal path SRMSD and a full distance matrix for all pairs of molecules. Srmsd ( as1 as2 matrix [chemical] )
returns the "optimal path" srmsd where for each molecule the smallest rmsd is accumulated.
The function also returns M_out with Srmsd values for all pairs of molecules.
The dimensions of the M_out matrix will be Nof(Mol( as1 )) x Nof(Mol( as2 )) .
This function will consider two residues equivalent if they have the same residue numbers and two
atoms equivalent if they have the same names.
If no equivalences are found the srmsd value of 999. is returned.
Srmsd ( as_pharmTemplate as_chem [pharmacophore] )
- returns real value of root-mean-square deviation of pharmacophore points between as_pharmTemplate and as_chem.
Example:
read binary s_icmhome + "example_ph4.icb"
parrayToMol t_3D.mol[4949]
superimpose a_pharma. a_2. pharmacophore
display a_2.
Srmsd( a_pharma. a_2. pharmacophore )
See also: Rmsd superimpose create a pharmacophore object
[ String substring | String mol | Alignment_as_text | Ali_seq_project | Seq_ali_project | String alternative | String selection | String slide gui | Chem formula ]
function.
String ( sequence )
- converts sequence into a string
String ( integer )
- converts integer into a string . see Tostring
String ( real [ i_nOfDecimals] )
- converts real into a string .
It also allows to round a real number to a given number of digits after decimal point.
String ( string, i_NofRepeats )
- repeat specified string i_NofRepeats times
String ( string, all )
- adds flanking quotes and extra escape symbols to write this string in a form interpretable in shell in $string
expression.
String ( string, html )
- return URL-encoded version of the input string argument. See also Table-urland Collection to parse URL encoded strings.
String ( collection, html )
- return URL-encoded query string from the input collection argument. See also Table-urland Collection to parse URL encoded strings.
String ( s_input, s_default )
- if the input s_input string is empty returns the s_default, otherwise returns the s_input string
String ( string, i_offset, i_length )
- returns substring of length i_length. If i_length is negative returns substring from
the offset to the end.
String ( { iarray | rarray | matrix } plot [ s_translateString ] )
- converts numbers into a string
or ascii characters (the "Ascii art", i.e. 12345 -> "..:*#").
The range between the minimal and maximal values is equally divided into
equal subranges for each character in the string. This function
is useful for ascii visualization of arrays and matrices. The default
translation string
is ".:*0#". Another popular choice is "0123456789".
Examples:
file=s_tempDir//String(Energy("ener")) # tricky file name
show Index(String(seq),"AGST") # use Index to find seq. pattern
tenX = String("X",10) # generate "XXXXXXXXXX"
show String(Random(1.,10.,30), plot )
read matrix
show String(def," ..:*#") # redefine the projection symbols
See also: Tostring , show map.
Extracting a substring or reversing the order of characters in a string |
String ( i_from, i_to, string )
- returns substring starting from i_from and ending at i_to.
If i_from is less than i_to the string is inverted.
Zero value is automatically replaced by the string length, -1 is the last but one element etc.
Examples:
String(1,3,"12345") # returns substring "123"
String(4,2,"12345") # returns substring "432"
String(1,0,"12345") # returns "12345"
String(0,1,"12345") # returns INVERTED string "54321"
String(-1,1,"12345") # returns "4321"
Export a chemical or chemical array as sdf text. |
String( X_ ) ⇒ s_sdfFile
generates a string buffer in mol/sdf file format.
This can be used to read one or multiple chemicals from a table into 3D objects
in ICM shell.
Example:
group table t Chemical("CC=O")
read mol input=String(t.mol[1]) # creates 3D objects
# to write as a file use write table mol t
String( T_ mol ) ⇒ s_sdfFile
generates string buffer in mol/sdf format for the table or table selection.
All table fields are included into the result
Example:
add column t Chemical({"Cc1ccc(C)c(c1)c1c(C=C2C(N(CC(O)=O)C(=S)S2)=O)cn(c2ccccc2)n1", "COc1cccc(C=C2C(N(CCC(O)=O)C(=S)S2)=O)c1OCC=C"})
add column t Predict(t.mol,"MolLogP") name="MolLogP"
String( t[1] mol )
Converting an alignment into text |
String ( ali_ )
- converts the alignment into a multiline string .
You can further split it into individual lines like "--NSGDG"
with the Split(String(ali_)) command.
The offset in a specific sequence and its number can be found as follows.
Examples:
read alignment s_icmhome+"sh3"
offs=Mod(Indexx(String(sh3),"--NSGDG"),Length(sh3)+1)
# extract alignment into a string, (+1 to account for '\n')
iSeq = 1 + Indexx(String(sh3),"--NSGDG")/(Length(sh3)+1)
# identify which sequence contains the pattern
String ( ali_ tree )
- returns a Newick tree string describing the topology of the evolutionary
tree. The format is described at
http://evolution.genetics.washington.edu/phylip/newicktree.html .
Example:
read alignment s_icmhome+"sh3"
show String(sh3 tree)
Projecting properties from alignment to a member sequence. |
String ( s_ali ali_from { seq_ | i_seqNumber } )
- returns a projected string . The s_ali string contains characters
defined for each position of alignment ali_from. The function squeezes out the
characters which correspond to insertions into sequence seq_ .
This operation, in effect, projects the alignment string s_ali onto sequence seq_.
See also the
Rarray(R_,ali_,seq_) function to project rarrays.
Example (projection of the consensus string onto a sequence):
read alignment s_icmhome+"sh3" # 3 seq.
cc = Consensus(sh3)
show String(Spec)//String(cc,sh3,Spec)
Projecting properties from member sequence to alignment |
String ( s_seq { seq_ | i_seqNumber } ali_to s_gapDefChar )
- projects the input
string from seq_ to ali_to (the previous function does it in the opposite direction). The R_seq string contains characters
defined for each position of the sequence seq_. The function fills the gap positions in the
output with the r_gapDefChar character.
Combination of this and the previous functions allow you to project any string s1 from
one sequence to another by projecting the s1 of seq1 first to the alignment and than back to
seq2 (e.g. String( String(s1,seq1,a,"X") , a, seq2) ).
See also the
Rarray( R_,seq_,ali_,r_gapDefault ) function to project real arrays.
Example (transfer of the secondary structure from one sequence to another):
read alignment s_icmhome+"sh3" # 3 seq.
ssFyn = Sstructure(Fyn)
set sstructure Spec String(String(ssFyn,Fyn,sh3,"_"),sh3,Spec)
show Spec
Returning one of two alternatives depending on a condition |
String( l_condition s_choice1 s_choice2 )
This function is equivalent to the question mark operator in C, e.g. condition?choice1:choice2
Example:
a=3
String( a>1 , "big a", "small a" )
String( selection ): converting selections into the text form |
String( { os_ | ms_ | rs_ | as_ } [ name | number ] [ i_number ] )
String( { os_1 | ms_onOneObj } simple )
converts a selection into a compact string form.
Continuous blocks of selected elements in different molecules or objects are separated
by vertical bar ( | ) which means logical or ( e.g. a_a.1:4|a_b.2,14 )
You can also divide this selection info a string array with the Split function.
Option i_number allows to print only i-th element of the selection.
It is convenient in scripts. For atom selections it will also show
full information about each atom, rather than only the ranges of atom numbers.
This string form is convenient used for several purposes:
- to store selections in tables and arrays.
- to transfer selections from object to object and from session to session
(see also the Select function)
With option name , the one-letter residue code will be shown in addition to the number, regardless of the l_showResCodeInSelection system logical ( e.g. a_/^F23 instead of a_/23 ). Conversely option number shows only the number.
By default (without the name option) the code is shown depending on the l_showResCodeInSelection flag.
Options:
- simple : a special function that returns the selection in terms of the name of a single object (make sure that only one object is selected) and
- name | number : allows to show or hide, respectively, the one-letter code of a residue (e.g. '^W123').
the names of the molecules (e.g. a_1abc.a ). See also the Name function to get object of molecule names (e.g. Name( a_1. ) ↑ "1abc" )
An example in which we generate text selection of the Crn leucine neighbors :
nice "1crn"
l_showResCodeInSelection = no
nei = String( Res(Sphere( a_/leu a_/!leu , 4.)) )
show nei
a_1crn.a/14:17,19:20
display xstick $nei
Another example with a loop over atom selection of carbon atoms:
read pdb "2ins"
for i=1, Nof( a_//c* )
print String( a_//c* i )
endfor
See also: l_showResCodeInSelection
Retrieve window layout string from a slide |
String( slide gui ) ⇒ s_layoutString
retrieves the string with the window layout information which is stored in the slide.
Example:
sl = Slide(gui)
undisplay window="all"
# take a look
display window=String( sl gui )
See also: Slide, display window.
String ( as_ { dot | all | smiles | sln } )
- returns string with the following chemical information:
| option | description | example
|
|---|
| all | chemical formula | e.g. C2H6O
| | dot | chemical formula with dot-separated molecules | e.g. C2H6O.C3H8
| | smiles | smiles string | e.g. [CH3][CH2][OH]
| | sln | sln notation | e.g. CH3CH2OH
|
Molecules with a certain chemical formula (calculated without hydrogens)
can be selected by the a_formula1,formula2.. selection .
See also: Smiles , smiles , selection by molecule.
Example:
build string "se ala" # alanine
show String(a_//!h* all ) # returns no hydrogen chemical formula: C3NO
show String(a_//* all ) # returns chemical formula: C3H5NO
show String(a_//* sln ) # returns SLN notation: NHCH(CH3)C=O
show String(a_//* smiles) # returns SMILES string: [NH][CH]([CH3])C=O
secondary structure function.
Sstructure ( rs_ )
- returns string
of secondary structure characters ("H","E","_", etc.) extracted from specified residues `rs_ .
Sstructure ( { rs_ | s_seqStructure } compress )
- returns the compressed string
of secondary structure characters, one character per secondary structure
segment, e.g. HHE means helix, helix, strand.
Use the
Replace function to change B to '_' and
G helices to H helices, or simply all non H,S residues to coil
(e.g. Sstructure(Replace(ss,"[!EH]","_"),compress) )
Example:
show Sstructure("HHHHHHH_____EEEEE",compress) # returns string "HE"
#
read object "crn"
show Sstructure( a_/A , compress) # returns string "EHHEB"
Sstructure ( { seq_ | s_sequenceString } )
- returns string
of secondary structure characters ("H","E","_").
If this string has already been assigned to the sequence seq_ with the
set sstructure command or the
make sequence ms_ command, the function will return
the existing secondary structure string. To get rid of it, use the
delete sstructure command.
Alternatively, if the secondary structure is not already defined,
the Sstructure function will predict the secondary structure of the seq_
sequence with the Frishman and Argos method.
If the specified sequence is not a part of any
alignment of sequence group only a single sequence
prediction will be effected (vide infra). Otherwise, a group or an alignment
will be identified and a true multiple sequence prediction algorithm is applied. The
multiple sequence prediction by this method reaches the record of 75% prediction accuracy
on average for a standard selection of 560 protein chains under rigorous jack-knife
conditions. The larger the sequence set the better the prediction. Prediction accuracy
for a single sequence is about 68%. To collect a set perform the fasta search (
Pearson and Lipman, 1988
) with ktup=1 and generate a file with all the sequences in a fasta format.
Method used for derivation of single sequence propensities.
Seven secondary-structure related propensities are combined to produce the final
prediction string. Three are based on long-range interactions involving potential
hydrogen bonded residues in anti-parallel and parallel beta sheet and alpha-helices.
Other three propensities for helix, strand and coil, respectively, are predicted by the
"nearest neighbor" approach (
Zhang et al., 1992
), in which short fragments with known secondary structure stored in the database
(icmdssp.dat) and sufficient similarity to the target sequence contribute to the
prediction. Finally, a statistically based turn propensity (also available separately
via the
Turn( sequence)
function), is employed over the 4-residue window as described by
Hutchinson and Thornton (1994).
The function also returns four real arrays in the
M_out
matrix
[4, seqLength]. There arrays are:
- M_out[1] : alpha-helix propensity [0., 1.]
- M_out[2] : beta-sheet propensity [0., 1.]
- M_out[3] : coil propensity [0., 1.]
- M_out[4] : prediction reliability [0., 1.]
Note that these propensities are not directly related to the prediction.
Usually the reliability level of 0.8 guaranties prediction accuracy of about 90%.
Do not be surprised if the propensities are all zero for a fragment. It may just
mean that the statistics is too scarce for a reliable estimate.
Sstructure ( seqarray )
- returns sarray of secondary structure strings stored in a sequence parray
Examples:
show Index(Sstructure(a_1crn.,"HHHHHH")) # first occurrence of
# helix in crambin
read sequence "sh3" # load 3 sequences (the full name is s_icmhome+"sh3")
show Sstructure(Spec) # secondary structure prediction for one of them
show Sstructure("AAAAAAAAAAAAA") # sec. structure prediction for polyAla
read sequence "fasta_results.seq"
group sequences a unique 0.05 # remove redundant sequences
show Sstructure(my_seq_name) # the actual prediction, be patient
plot number M_out display # plot 3 propensities and reliability
[ Sum chemical | Sum image ]
function.
Sum ( iarray )
- returns the integer sum of iarray elements.
Sum( { rarray | map })
- returns the real sum of elements.
Sum ( matrix )
- returns the rarray of sums in all the columns.
Sum ( sarray [ s_separator ] )
- returns string of concatenated components of a sarray separated by
the specified s_separator or blank spaces by default.
See also the opposite function: Split .
Examples:
show Sum({4 1 3}) # 8
show Sum(Mass(a_1//*)) # mass of the first molecule
show Sum({"bla" "blu" "bli"}) # "bla blu bli" string
show Sum({"bla" "blu" "bli"},"\t") # separate words by TAB
show Sum({"bla" "blu" "bli"},"\n") # create a multiple line string
>>Sum-multisep
h4-- Concatenate multiple columns
Sum( T_table { S_cols } s_sep1 s_sep2 ) ⇒ S_result
- returns sarray where each element formed as follows:
colname1sep2value1sep1colname2sep2value2 ...
Empty values are skipped. This function can be used to 'shrink' sparse tables
Example:
add column t {"" "a" "" "" "b"} {"c" "" "j" "r" ""} {"a" "u" "" "" "b"}
Sum( t ":", "=" )
See also: Split multisep
Sum ( chemarray [r_spacing=0.] )
Merges elements of into one molecule. If is equal to zero
no translation will be done. Otherwise elements will be arranges in XY plane with
specified spacing at X axis.
This function can be used to merge several PDB ligands into one molecule
Example:
read pdb "1zkn"
read mol input=String(Sum( Chemical( a_ibm,ibm2 exact )) ) split name="twoMolsInOne"
See also: Split chemical other chemical functions
Sum ( imageArray_a imageArray_b [r_bweight(0.5)] )
creates an image array consisting of blended images from arrays imageArray_a and imageArray_b.Arrays should have the same size and each image pair in the arrays should have matching sizes as well.
The r_bweight parameter specifies how much of the color in resulting image should be taken
from the second array images. r_bweight should be a value between 0 and 1.
See also: Image
function.
Symgroup ( { s_groupName | os_object | i_groupNumber | m_map } number )
- returns the integer number of one of 230 named space groups defined in ICM.
Symgroup ( { i_groupNumber | os_object | m_map } )
- returns the string name of one of 230 space groups defined in ICM.
The number of transformations for all two versions is returned in i_out .
See also, Transform :
Transform ( i_groupNumber )
- returns the rarray of transformation matrices (12 numbers each) describing symmetry operations
of a given space group.
Examples:
iGroup = Symgroup("P212121" number ) # find the group number=19
print "N_assymetric_units in the cell =", i_out
show Transform(iGroup)) # shows 4 12-membered transformations.
[ Table url_decoder | Alignment as table | Residue correspondences | Table matrix | Table pairs | Table stack | Table model | Site table | Table distance ]
generic function return a table.
- : Table ( [crypt] ) =>
- : Table( []) =>
- : Table( term|merit) =>
- : Table() => (name,n,freq)
- : Table( site) => (key,fr,to,list,desc)
- : Table( [number]) =>
- : Table( residue|label) =>
- : Table(loop) => T_
- : Table(stack [] ) =>
- : Table ( []) =>
- : Table (
- : Table( ) =>
- : Table( distance ) =>
Table: decoding a URL string |
Table ( s_URL_encoded_String [ crypt ] )
- returns the table of "name" and "value" pairs organized in two
string arrays.
The URL-encoding is a format in which the HTML browser sends the HTML-form input
to the server either through standard input or an environmental variable.
The URL-encoded string consists of a number of the "name=value&name=value..."
pairs separated by ampersand ( & ). Additionally, all the spaces are
replaced by plus signs and special characters are encoded as hexadecimals with
the following format %NN. The Table function decodes the string and creates
two string arrays united in a table.
Option crypt allows to interpret doubly encoded strings
(e.g. ' ' is translated to '+' which then converted into a
hexadecimal form). Frequently the problem can be eliminated by specifying
the correct port. Example: you need to set a="b c" and d="<%>".
Normal server will convert it to a=b+c&d=%3C%25%3E.
Double encoding leads to a=b%2bc&d=%253C%2525%253E.
To parse the last string, use the crypt option.
To see all the hidden symbols (special attention to '\r'),
set l_showSpecialChar =yes.
Examples:
read string # read from stdin in to the ICM s_out string
a=Table(s_out) # create table a with arrays a.name and a.value
show a # show the table
for i=1,Nof(a) # just a loop accessing the array elements
print a.name[i] a.value[i]
endfor
See also:
Getenv( ).
Converting alignment into a table |
Table ( alignment [ number ] )
- returns the table of relative amino acid positions for each of the sequence
in the alignment. Gaps are marked by zero.
Note that here columns correspond to different sequences while rows correspond to alignment positions.
In the next function this order is reversed.
The first column of the table, .cons , contains sarray of consensus characters.
All the other arrays are named according to the sequence names by default, or
by the sequential number of a sequence in the alignment, if option number is specified.
The table may be used to project numbers from one sequence to another.
See also the Rarray( R_, ali_, seq_ ) function.
This table may look like this:
#>T pos
#>-cons----seq1-----seq2-------
" " 0 1
" " 0 2
C 1 3
" " 2 0
~ 3 4
C 4 5
" " 0 6
# for the following alignment:
# Consensus C ~C
seq1 --CYQC-
seq2 LQC-NCP
To calculate an array of mean scores for each column of a multiple sequence alignments use the Rarray( ali [ exact ] ) function.
This array can be appended to the table.
Example:
read alignment "sh3"
t = Table(sh3 number) # arrays t.1 t.2 t.3
t = Table(sh3) # arrays t.cons t.Fyn t.Spec t.Eps8
#
cc = t.cons ~ "[A-Z]" # all the conserved positions
show cc # show aa numbers at all conserved positions
show t.Fyn>=10 & t.Fyn<=20 # numbers of other sequences in this range
See also, the next function
Outputting a table of residue numbers for corresponding positions |
Table( alignment, I_alignmentPositions , residue | label )
returns a table of corresponding residue numbers for the selected positions
I_alignmentPositions . With option residue only the numbers are returned,
while under the label option, the residue labels (e.g. Y25 ) are returned.
If an alignment is linked to a 3D molecule, all cell of this row will show
both sequence numbers, as well as residue numbers of the linked 3D molecule, see
example below.
Note that in contrast to the previous function, this function looks like an alignment
and has the same orientation. Each row corresponds to a different sequence,
the sequence name is stored in the first column, while other columns contain
residue numbers in the selected alignment positions.
Example:
Table( aaa {1 11 13 16} label ) # aaa contains three sequences
| seq | 1 | 11 | 13 | 16 | comment |
|---|
| 1fyn_a | | L10,90 | D12,92 | A15,95 | this sequence is linked to molecule a
| | Spec | D1 | L11 | D13 | E16 | Spec sequence positions starting from 1
| | Eps8 | K1 | K11 | D13 | A16 | Eps8 sequence positions starting from 1
|
Converting matrix into table columns |
Table ( matrix [ S_colnames ] ) ⇒ T
- returns table with matrix columns named 'A', 'B', .. or according to the second argument.
Example:
t= Table(Matrix(3),Sarray(3,"A")+Count(3))
show t
>T t
#>-A1---A2---A3----
1. 0. 0.
0. 1. 0.
0. 0. 1.
The inverse operation can be done with Matrix ( table , S_colNames ) function.
Converting a square symmetrical matrix to a table with pairs of elements. |
Table(matrix_nxn S_matrix_colnames_n S_matrix_rownames_n) ⇒ T_ij_pairs
This function will check if the matrix is square and symmetrical and will return a table
with three columns, named A,B,C containing a two names of elements and their Mij value.
It will not return the diagonal values.
Example:
build string "ala"
m=Distance(Xyz(a_//c*) Xyz(a_//c*) ) # carbon distance matrix
ats = Sarray( a_//c* )
t = Table(m ats ats)
t
Extracting parameters of stack conformations |
Table( stack [ vs_ ] )
- return table of parameters for each conformation in a stack .
If a variable selection argument is provided, the values
of the specified variables are returned as well.
% icm
build string "ala his trp"
montecarlo
show stack
iconf> 1 2 3 4 5 6 7
ener> -15.1 -14.6 -14.6 -14.2 -13.9 -11.4 -1.7
rmsd> 0.3 39.2 48.0 44.1 27.4 56.6 39.3
naft> 1 0 0 1 1 1 0
nvis> 4 1 1 4 4 4 1
t= Table(stack)
show t
#>T t
#>-i--ener--------rmsd--------naft--------nvis-------
1 -15.126552 0.295555 1 4
2 -14.639667 39.197378 0 1
3 -14.572973 47.996203 0 1
4 -14.220515 44.058755 1 4
5 -13.879041 27.435388 1 4
6 -11.438268 56.636246 1 4
7 -1.654792 39.265912 0 1
t1= Table(stack v_//phi,psi) # show also five phi-psi angles
#>T
#>-ener----rmsd--naft-nvis------v1------v2------v3------v4-------v5-----
1 -15.12 0.29 1 4 -79.10 155.59 -75.30 146.99 -141.13
2 -14.63 39.19 0 1 -157.22 163.56 -78.25 139.51 -137.30
3 -14.57 47.99 0 1 -157.26 166.87 -85.08 92.55 -84.74
4 -14.22 44.05 1 4 -67.65 80.43 -76.67 103.05 -81.85
5 -13.87 27.43 1 4 -82.72 155.86 -85.02 93.11 -81.46
6 -11.43 56.63 1 4 -78.28 152.80 -154.79 66.26 -77.61
7 -1.65 39.26 0 1 -78.17 169.41 -133.89 96.39 -96.03
See also: Iarray stack function
Column weights in PLS models and relative contributions of the descriptors. |
Table( plsModelName term )
returns a table with three columns: name mean rmsd, -w (weight) and -wRel
columns.
The header of the table contains the free term ( constant b ).
The linear model can be represented as
Ypred = b + w1*X1+w2*X2+...The wRel column returns the following value:( Abs(wk) * Rmsd(Xk) ) / Sum_k( Abs(wk) * Rmsd(Xk) )
Example:
A = Random(1. 10. 20)
group table T A A*2. "B" Random(1. 10. 20) "C" Random(1. 10. 20) "D"
write binary Apred
delete Apred
#
read binary "Apred"
Table( Apred term )
#>r .b
0.012402
#>r .self_R2
0.999998
#>r .test_R2
0.999885
#>r .self_rmse
0.002908
#>r .test_rmse
0.030066
#>T
#>-name--------mean--------rmsd--------w-----------wRel-------
B 11.04767 4.620291 0.499992 99.726648
C 5.749607 2.681675 -0.001182 0.13679
D 4.686537 2.686346 -0.001178 0.136562
Retrieving sequence site information |
Table( site seq ) ⇒ T_allSites
Example:
read pdb "1f88"
make sequence
Table( 1f88_a site)
#>T
#>-key---------fr----------to----------list--------desc-------
CARBOHYD 15 15 "" "glycosylation site "
CARBOHYD 2 2 "" "glycosylation site "
Exporting a table from an interatomic distance object of hydrogen bond parray. |
Table( hbondpairs|atompair_distances|angles|torsions distance ) ⇒ T_atomsPairs
- takes a distance object and returns a table with the following columns
atom1 # selection , e.g. a_a.b/^T3/cn
atom2 # second atom
dist # distance in Angstroms
color # color if present
label # label of this distance
Angles and torsions will also have atom3 and atom4 columns.
Example in which we find the shortest hydrogen bond in crambin:
read pdb "1crn"
convertObject a_ yes yes no no
make hbond name="hbonds_crn"
show Nof( hbonds_crn ) # counts distances
t = Table( hbonds_crn distance )
sort t.dist
show t[1]
See also: make distance , make hbond , Nof-distance{Nof(d,distance)}
tangent trigonometric function.
Arguments are assumed to be in degrees.
Tan ( { r_Angle | i_Angle } )
- returns the real value of the tangent of its real or integer argument.
Tan ( rarray )
- returns rarray of the tangents of each component of the array.
Examples:
show Tan(45.) # 1.
show Tan(45) # the same
show Tan({-30., 0. 60.}) # returns {-0.57735, 0., 1.732051}
hyperbolic tangent function.
Tanh ({ r_Angle | i_Angle } )
- returns the real value of the hyperbolic tangent of its real or integer argument.
Tanh ( rarray )
- returns rarray of the hyperbolic tangents of each component of the array.
Examples:
show Tanh(1) # returns 0.761594
show Tanh({-2., 0., 2.}) # returns -0.964028, 0., 0.964028
function the second moments for a multidimensional distribution.
Tensor ( M_)
- returns the square matrix of second moments of K points in N -dimensional space,
Mki (k=1,K,i=1,N) .
The matrix NxN is calculated as
< Xi >< Xj > - < Xi Xj >
, where < .. > is averaging over a column k=1,K, and i,j=1,N.
If xyz is a coordinate matrix Nx3, the Tensor function is identical to
Transpose( xyz ) * xyz / Nof(xyz)
- In one-dimensional case, N=1, when M_ is just one column (k=1,K; i=1,1)
the function returns a one by one matrix with the mean-square-deviation
of the vector (which is equal to Rmsd(R_)*Rmsd(R_)).
- N=2, x and y dimensions; In this case the function returns the 2 by 2 matrix:
with <x>2-<x2>
and <y>2-<y2>
on the diagonal and
<x><y>-<xy> off-diagonal elements.
- In three-dimensional case the function returns three by three tensor of inertia
(it was too tiring to type the formula in html). This matrix is useful for superposition
of bodies or molecules on the basis of shape, since three principal coordinates can be
easily derived from the tensor using the Eigen or Disgeo functions.
This trick used in the dockScan script ( _dockScan.
Example:
build string "AAA" # a long molecules
xyz = Xyz( a_//c* ) # a coordinate matrix of carbons
# you can also do it with grobs: xyz = Xyz( g_myGrob )
a=Tensor(xyz) # compute 3 by 3 matrix of the second moments
b=Eigen(a) # returns 3 axis vectors
ax1= b[?,1] # this is the longest half axis
ax2= b[?,2] # this is the second half axis
ax3= b[?,3] # this is the shortest half axis
len1 = Length(ax1) # long axis length
len2 = Length(ax2) # mid axis length
len3 = Length(ax3) # short axis length
r = Matrix(3,3)
# to make the rotation matrix from b normalize the axes
r[?,1] = ax1 / Length( ax1 )
r[?,2] = ax2 / Length( ax2 )
r[?,3] = Vector( r[?,1], r[?,2] )
rotate a_ Transpose(r) # rotates the principal axes to x,y,z
# x the longest
This commands are assembled in the calcEllipsoid M_xyz macro which returns
ellipseRotMatrix , and three vectors: ellipseAxis1 , ellipseAxis2 and ellipseAxis3
See also:
Rot, rotate, transform
<>
Example to orient the principal axes of the molecule along X,Y and Z
(the longest axis along X, etc.).
build string "se ala ala ala ala" # let is define the ellipsoid
display virtual
a = Tensor(Xyz(a_//!h*)) # Xyz returns matrix K by 3
b=Eigen(a) # 3x3 matrix of 3 eigenvectors
b[?,1] = b[?,1] / Length( b[?,1] ) # normalize V1 in place
b[?,2] = b[?,2] / Length( b[?,2] ) # normalize V2
b[?,3] = Vector( b[?,1], b[?,2] ) # V3 is a vector product V1 x V2
rotate a_ Transpose( b ) # b is the rotation matrix now
# Transpose(b) is the inverse rotation
set view # set default X Y Z view
function returning
the oligonucleotide duplex melting temperature.
Temperature ( { s_DNA_sequence | seq_DNA_sequence } [ r_DNA_concentration_nM [ r_Salt concentration_mM ] ] )
- returns the real melting temperature of a DNA duplex at given
concentration of oligonucleotides and salt. The temperature is
calculated with the Rychlik, Spencer and Roads formula
(Nucleic Acids Research, v. 18, pp. 6409-6412)
based upon the
dunucleotide parameters provided in Breslauer, Frank, Bloecker,
and Markey, Proc. Natl. Acad. Sci. USA, v. 83, pp. 3746-3750.
The following formula is used:
Tm=DH/(DS + R ln(C/4)) -273.15 + 16.6 log[K+]
where DH and DS are the enthalpy and entropy for helix formation,
respectively, R is the molar gas constant and C is the total molar
concentration of the annealing oligonucleotides when oligonucleotides are not self-complementary. The default concentrations are C=0.25 nM and
[K+]= 50 mM. This formula can be used to select
PCR primers and to select probes for chip design.
Usually in primer design the
temperatures do not differ from 60. by more than several degrees.
function returning time spent in ICM.
Time ( string )
- returns the string of time (e.g. 00:12:45 ) spent in ICM.
Time ( )
- returns the real time in seconds spent in ICM.
Examples:
if (Time( ) > 3660.) print "Tired after " Time(string) " of work?"
convert to integer values or arrays.
Tointeger ( string|real|integer|logical )
- converts to integer
Tointeger ( sarray|rarray|iarray )
- converts each element to integer, returns iarray.
Tointeger ( R_source R_splitPoints I_values )
- maps real numbers from the R_source to integers.
The R_splitPoints array of a size n should contain numbers in increasing order.
Those n points will be used as split points for n+1 intervals.
I_values of size n+1 specifies numbers to be assigned to values in each of those intervals.
Example in which we form two classes for positive and negative values.
Useful, e. g. in classification problems .
Tointeger( {-1., -2., 3. 4. 5. 6.},{0.},{-1,1} )
{-1, -1, 1, 1, 1, 1}
A more general splitter:
Tointeger({1. 2. 3. 4. 5. 6.},{2.5,4.5},{2,4,6})
Tointeger ( S_source S_labels I_values )
Tointeger ( I_source I_labels I_values )
- these functions recode source, replacing each value found in labels array
by the respective value from the values array. Thus, values array should have
the same number of elements as the labels array. Alternatively, it may contain an extra element,
and that last element will be interpreted as the default value for everything from the source not listed in labels.
Example:
Tointeger( {"dit" "dah" "dah" "dah" "dit" "dah"} {"dit" "dah"} {0 1} )
0 1 1 1 0 1
Tointeger( {"dit" "dah" "dah" "XXX" "dit" "dah" "YYY" "dah"} {"dit" "dah"} {0 1 100} )
0 1 1 100 0 1 100 1
Tointeger( {1 5 1 5 6 7 6 1} {1 5} {2 3 0} )
2 3 2 3 0 0 0 2
See also:
Toreal( ), Tostring( )
convert to the lowercase.
Tolower ( string )
- returns the string converted to the
lowercase. The original string is not changed
Tolower ( sarray )
- returns the sarray converted to the
lowercase. The original sarray is not changed.
Examples:
show Tolower("HUMILIATION")
read sarray "text.tx" #create sarray 'text' (file extension is ignored)
text1 = Tolower(text)
See also:
Toupper( ).
convert to real values or arrays.
Toreal ( string|real|integer )
- converts to real
Toreal ( sarray|rarray|iarray )
- converts each element to a real, returns a real array. see Rarray( ).
Toreal ( S S_n_keys R_n1_values ) # R_values has n or n+1 elements
- converts each key to a respective real value. If values contains n+1 elements,
the last value is the deault value (used to convert all keys not in keys).
Example:
Toreal({"c","a","c","c"},{"c","a"},{1,2}) # two classes
{1, 2, 1, 1}
Toreal({"c","a","q","c","k"},{"c","a"},{1.8,2.3,0.5}) #with default value 0.5
{1.8, 2.3, 0.5, 1.8, 0.5}
Support for special values in real arrays.Section rarray constant describes special values in real arrays that may appear in real columns of tables upon reading the Excel/csv files
or property fields of the sdf.
Example:
Create file 't.csv' that looks like this:
1.1
ND
3.3
INF
>3.
<2.
To compare an array with special values with a specific special value use this:
read csv "t.csv"
t.A == Toreal({"ND"})
t.A != Toreal({"ND","INF"})
t.A == Toreal({">3."})
See also:
Tointeger( ), Tostring( )
angle function.
Torsion ( as_ )
- returns the real torsion angle defined by the specified atom as_
and the three previous atoms in the ICM-tree.
For example, Torsion(a_/5/c) is defined by
{ a_/5/c , a_/5/ca , a_/5/n , a_/4/c } atoms.
You may type:
print Torsion( and then click the atom of interest, or use GUI to calculate the angle.
Torsion ( as_atom1, as_atom2, as_atom3, as_atom4 )
- returns the real torsion angle defined by four specified atoms.
Examples:
d=Torsion( a_/4/c ) # d equals C-Ca-N-C angle
print Torsion(a_/4/ca a_/5/ca a_/6/ca a_/7/ca) # virtual Ca-Ca-Ca-Ca
# torsion angle
convert to integer values or arrays.
Tostring ( string|real|integer )
- converts to string
Tostring ( sarray|rarray|iarray )
- converts each element to a string, returns sarray.
Tostring ( seqarray )
- returns sarray with sequences extracted from sequence parray elements.
See also:
Toreal , Tointeger , Sequence
convert to the uppercase.
Toupper ( string )
- returns the string converted to the uppercase. The original string is not changed
Toupper ( sarray )
- returns the sarray converted to the uppercase. The original sarray is not changed.
Toupper ( string|sarray 1 )
Examples:
show Toupper("promotion")
show Toupper("joseph louis gay lussac",1)
Joseph Louis Gay-Lussac
read sarray "text.tx"
text1 = Toupper(text)
See also:
Tolower( ).
translate one-character sequence to three-character notation.
Tr123 ( sequence )
- returns string like "ala glu pro".
Examples:
show Tr123(seq1)
See also:
Tr321( ).
IcmSequence( ).
translate three-character sequence to one-character notation.
Tr321 ( s_ )
- returns sequence
from a string like this: "ala glu pro". This function is
complementary to function
Tr123( ). Unrecognized triplets will
be translated into 'X'.
Examples:
show Tr123("ala his hyp trp") # returns AHXT
matrix function.
Trace ( matrix )
- returns the real trace (sum of
diagonal elements) of a square matrix.
Examples:
show Trace(Matrix(3)) # Trace of the unity matrix [3,3] is 3.
[ Dna translate ]
translation function. 3D translation vector or DNA sequence translation.
Trans ( R_12transformationVector )
- extracts the R_3
vector of translation from the
transformation vector.
Six frame DNA/RNA sequence translation |
Trans ( seq_DnaOrRnaSequence )
- returns the translated DNA or RNA sequence ('-' for a
Stop codon, 'X' for an ambiguous codon) using the
standard genetic code.
See also:
Sequence( seq_ reverse ) for the reverse complement DNA/RNA sequence.
Example (6 reading frames):
w=Sequence("CGGATGCGGTGTAAATGATGCTGTGGCTCTTAAAAAAGCAGATATTGGAG")
show Trans(w), Trans(w[2:999]),Trans(w[3:999])
c=Sequence(w,reverse)
show Trans(c), Trans(c[2:999]),Trans(c[3:999])
Trans ( seq_DnaOrRnaSequence { all | frame } [ i_minLen] [ s_startCodons] )
return a table
of identified open reading frames in DNA sequence not shorter than i_minLen .
The function was designed for very large finished sequences from the genome
projects. Currently the Standard Genetic code is used.
Option s_startCodons allows to provide a comma-separated list of starting codons;
if omitted, the default is "ATG" , another example would be "ATG,TTG"
(for S.aureus).
Option frame indicates that both start and stop codons need to be found.
If they is not found or the fragment is too short, the table will be empty.
Option all allows to translate ALL POTENTIAL peptides by assuming
that the start and/or stop codons may be beyond the sequence fragment. In this
case, initially all 6 frames are produces. Later, some of them can be filtered out
by the i_minLen threshold. The unfinished end codons will be marked by 'X'.
The table has the following structure:
- frame - integer 1 2 3 for the direct chain, or -1, -2, -3 for the complementary chain, respectively
- left - translation offset in the direct strand (even if translation occurred
in the complementary chain)
- right - translation offset in the direct strand.
- dir - direction (+1 for the direct, -1 for the complementary)
- len - fragment length
- seq - sequence string
For example, if the fragment is in the complementary strand it may have
the following parameters:
#>-frame-------left--------right-------dir---------len---------seq--------
-1 22 57 -1 12 XCVXVAAESVAS
In this case translation follows the reverse strand (frame=-1),
starts in position 57 of the original direct sequence and proceeds
to position 22.
Example:
dna=Sequence("TTAAGGGTAA TATAAAATAT AAAGTTCGAA CAATACCTCA CTAGTATCAC AACGCATATA")
T=Trans(dna frame 10)
sort T.left
show T
Transform family of functions. |
Transform( s_group|iGroup|os_1|map ) ⇒ R_12N_all_fract_transformations
Transform( s_group|iGroup|os_1|map iTrans )⇒ R_12_fract_transformation_i
Transform( s_group iTrans R_6cell ) ⇒ R_12_abs_transformation_i
Transform( obj "bio" i_biomol ) ⇒ R_12N_abs_BIOMT_transformations
Transform( s_symbolic_transformation )⇒ R_12 # not ready
Transform( R_6 )⇒ R_12
Transform( M_4x4 | M_3x3 ) ⇒ R_12_transformation
Transform( R_12 inverse ) ⇒ R_12_inverse_transformation
returns one or n transformations in the form of
one 12*n long vector. Here os_1 means selection of one single object (e.g. a_ for
the current object). The crystal symmetry and the biological symmetry can be imposed
with the set symmetry command.
matrix function.
Transpose ( matrix )
- converts the argument matrix[n,m] into the transposed matrix [m,n]
Transpose ( rarray )
- converts real vector [n] into a one-column
matrix [n,1]
Examples:
Transpose(a) # least squares fit
Transpose({1. 2. 3.}) # [3,1] matrix
Transpose( table [i_nameColumn] )
- converts the argument table[nrows,ncols] into the transposed table [ncols,nrows]
All columns in the result table will be assigned the same type which is determined from column types of the source table.
The result type can be either iarray, rarray or sarray.
Optional argument i_nameColumn specifies the column number in the source table which will be excluded from the transposition
and it's values will be used to assign column names in the result table.
Example:
read sequence "seqs"
group sequence "a"
align a
t = Table( a Count(Length(a)) label )
t2 = Transpose( t 1 ) # transpose and use first column values as result column names
(t2.Azur_Alcfa == "-").Azur_Alcde # get residue labels in Azur_Alcde which corresponds gaps in Azur_Alcfa
multiple functions to trim array/matrix/string (see several function templates below).
Trim ( R_ [ r_percentile [ i_mode ]] )
- returns rarray of softly trimmed values. The obvious outliers are softly moved closer to the expected distribution.
This is a clever auto-trim which identifies outliers defined
as values beyond the limits [a,b] projected from range of
the r_percentile values adjusted to 100% with 10% of additional margin.
The values within the limits are not changed but the outliers are brought
closer to the majority bounds. If i_mode is 0, the outliers are assigned
to the boundary values. If i_mode is 1, the values outside the range
are scaled down according to this formulae: d_new = b + log(1.+(d-b)/(b-a))
for high values and similarly for low values.
Return values:
- The function returns an array with corrected outliers.
- The adjusted boundaries are returned in the r_out and r_2out values.
- The number of outliers is returned in i_out .
By default r_percentile is 0.9 and i_mode is 0 .
Example:
Trim({0. 1. 4. 6.}) # keeps values unchanged
Trim({0. 1. 4. 6. 55.},0.9,1) # returns {0. 1. 4. 6. 11.3}
Trim({-33. 0. 1. 4. 6. 55.},0.9,1) # returns {-3.5 0. 1. 4. 6. 11.3}
Trim ( I_iarray i_lower i_upper )
- returns iarray clamped into the specified range. Values smaller than
i_lower are replaced with i_lower, and values greater than i_upper
are replaced with i_upper.
Trim ( R_rarray r_lower r_upper )
- returns rarray clamped into the specified range.
Trim ( i_ i_lower i_upper )
- returns integer clamped into the specified range (e.g. Trim(6,1,3) returns 3).
Trim ( r_ r_lower r_upper )
- returns real clamped into the specified range.
Trim ( M_matrix r_lower r_upper )
- returns matrix clamped into the specified range.
Trim ( m_gridMap r_lower r_upper )
- returns map clamped into the specified range. It means that all values above r_upper are set to r_upper, and all values below r_lower are set to r_lower.
Trim ( string [ all ] )
- returns string with removed trailing blanks and carriage returns. If option all is specified,
both leading and trailing blank characters will be removed.
Trim ( string maxNofCharacters [s_appendWhenTruncated] )
- trims to the maximal number of characters, it may appends specified trailing string if truncated.
Trim("123456",3) # returns "123"
Trim("123456",33) # returns "123456"
Trim("123456",3,"..") # returns "123.."
Trim ( string s_allowed_characters )
- returns string with in which only the allowed characters are retained.
All other characters are removed.
Example:
Trim("as123d","abcds")
asd
Trim ( string S_regularExpressionsToDelete )
- returns string in which all listed regular expressions are deleted.
Trim ( S_sarray [ all ] )
- returns sarray of strings with removed trailing blanks.
With option all it removes white space characters from both ends.
Trim irrelevant expression tag sequences from the domain sequence. |
Trim ( seq_ S_tagRegexps ) ⇒ seq_truncated
This function finds the matching regular expressions in the source sequence
and deletes it.
Note that the order is important and the longer patterns need to precede the shorter ones.
The pattern can be N-terminal (use ^) , a fragment in the middle, or C-terminal (use dollar $ )
There is a built in shell array called S_proteinTags that contains popular expression tags:
^.{0,11}HHHHHH
^.{0,5}HHHHH
^.{0,5}DYKDDDDK
DYKDDDDK.{0,3}$
HHHHHH.{0,6}$
YPYDVPDY.{0:3}$
AWRHPQFGG$
Feel free to modify it or provide your own list or fragments to be deleted.
Example:
read pdb sequence "1pme" # contains his-tag
cleanseq = Trim(1pme_a S_proteinTags ) # built in shell array
Align(1pme_a cleanseq)
1pme_a MSSSHHHHHHSSGLVPRGSHMAAAAAAGAG
cleanseq ----------SSGLVPRGSHMAAAAAAGAG
beta-turn prediction function.
Turn ( { seq_ | rs_ } )
- returns rarray containing beta-turn prediction index.
The index is derived from propensities for i,i+1,i+2,i+3 positions for each
amino-acid. Pi = pi+pi1+pi2+pi3, then high Pi values are assigned to the next
three residues. The propensities are taken from
Hutchinson and Thornton (1994).
Examples:
s = Sequence("SITCPYPDGVCVTQEAAVIVGSQTRKVKNNLCL")
plot comment=String(s) number Turn(s) display # plot Turn prediction
See also the predictSeq
macro.
[ Type soap | Type molcart ]
generic function returning type.
Type ( icm_object_or_keyword )
- returns a string
containing the object type
(e.g. Type(4.32) and Type(tzWeight) return string "real" ).
The function returns one of the following types:
"integer", "real", "string", "logical", "iarray", "rarray", "sarray", "aselection","vselection","sequence", "alignment", "profile", "matrix", "map", "grob", "command", "macro", "unknown".
Type (parray , 1 )
- returns the parray element type, like "mol" or "model".
Type ( as_ , 1 )
- returns a string containing the level of the selection ("atom","residue","molecule","object").
Type ( os_object , 2 )
Type ( os_object , object ) ⇒ S_objTypes
- returns a string (or an sarray with keyword object) containing the os_object (or current
by default) molecular object type. Defined types follow the EXPDTA (experimental data) card
of PDB file with some exceptions, see below:
| "ICM" | ready for energy calculations. Those objects are either built in ICM or converted to the ICM-type.
| | "X-Ray" | determined by X-ray diffraction
| | "NMR" | determined by NMR
| | "Model" | theoretical model (watch out!)
| | "Electron" | determined by electron diffraction
| | "Fiber" | determined by fiber diffraction
| | "Fluorescence" | determined by fluorescence transfer
| | "Neutron" | determined by neutron diffraction
| | "Ca-trace" | upon reading a pdb, ICM determines if an object is just a Ca-trace.
| | "Simplified" | special object type for protein folding games.
|
The non-ICM types can be converted to "ICM" with the convert command or convertObject macro.
The non-ICM types can be changed with the set type object command, e.g.
set type a_ "NMR"
Type ( { ms_ | rs_ }, 2 )
- returns the string type of the specified molecule or residue.
Legal types are "Amino", "Hetatm", "Nucl", "Sugar", "Lipid", "empty".
Residues of the "Amino" type can be selected with the 'A' character
(e.g. a_/A). See also a one-letter code for the type which is used
in selections, ( e.g. a_A,H ).
The molecule type can be reset with the set type ms_ s_type command,
e.g. ( set type a_2 "H" to switch to a heteroatom type.
Examples:
if (Type(a_1.1)!="Amino") goto skip: # deal only with proteins
if (Type( ) == "NMR") print "Oh, yes!"
Type ( as_ { atom | mmff } )
- returns an iarray containing the ICM or MMFF atom types. Example:
build string "his ala"
show Type(a_//!vt* atom ) # icm types for non-virtual atoms
Type ( as_1 as_2 )
- returns an integer containing the covalent bond type between the selected atoms.
Type( seq_ , 1 )
- returns the string type of the sequence. Two types are recognized:
"protein" and "nucleotide" .
An example in which we rename and delete all DNA sequences from the session:
read pdb sequence "1dnk"
Type( 1dnk_b, 1 )
nucleotide |